BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_O15 (608 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY187040-1|AAO39754.1| 211|Anopheles gambiae putative antennal ... 122 1e-29 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 26 1.1 AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 pr... 25 2.5 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 24 3.3 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 24 3.3 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 4.4 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 23 5.8 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 23 5.8 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 23 5.8 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 23 5.8 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 23 5.8 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 5.8 AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.7 >AY187040-1|AAO39754.1| 211|Anopheles gambiae putative antennal carrier protein A5 protein. Length = 211 Score = 122 bits (293), Expect = 1e-29 Identities = 57/111 (51%), Positives = 76/111 (68%), Gaps = 3/111 (2%) Frame = +1 Query: 52 QAFEASKIVPDVIPVAPTKNIELKYPSGAI-ASQGNELTPTQVKDQPSVTFEAEADAFYT 228 +AF ++IVP +I VAP + I++ YP + S GN+LTPTQVK +P + +E E A YT Sbjct: 30 EAFGRNEIVPGLIDVAPEQTIKITYPQSDVEVSLGNQLTPTQVKARPKLCWEVEPSALYT 89 Query: 229 LVFTDPD--NYDGPELVYREWHHWLVGNIPGGDLSAGETLSGYIGSGPPQG 375 L+ DPD + PE+ R W HWLVGNIPG D+ AG+ L+ Y+GSGPPQG Sbjct: 90 LLMADPDAPSRSNPEM--RSWKHWLVGNIPGADVDAGDVLADYVGSGPPQG 138 Score = 86.6 bits (205), Expect = 6e-19 Identities = 35/70 (50%), Positives = 55/70 (78%) Frame = +2 Query: 368 PRXTGIHRYVYILYKQPGKLDFDEKRLTNTSIDSRASFSTKKFAEKYNLGAPVAGNFYRA 547 P+ TG+HRYV+++YKQP ++ F+E L++ + +R ++ +F ++Y LG PVAGNFY+A Sbjct: 136 PQGTGLHRYVFLVYKQPSRIVFNETVLSSRN-PNRGKWNPAEFVKEYELGVPVAGNFYQA 194 Query: 548 QFDDYVPQLY 577 Q+DDYVP+LY Sbjct: 195 QYDDYVPELY 204 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 25.8 bits (54), Expect = 1.1 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 367 PQGYWDPSLRLHP 405 P G WDPS+R+ P Sbjct: 442 PPGEWDPSIRIEP 454 >AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 24.6 bits (51), Expect = 2.5 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -1 Query: 434 RSPIFLVVYKGCRRNDGSQXPWGGPEPMYPDRVSPAERSPPG 309 R P V G R + WG PE P+R +ER G Sbjct: 31 RVPKDTTVLIGLRTVHMDRDYWGDPEVFRPERFLESERDTAG 72 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 130 SGAIASQGNELTPTQVKDQPS-VTFEAEADAFYT 228 +GA +S + L + +D + +T +ADAF+T Sbjct: 85 AGASSSSSSSLLSSSAEDDVARITLSKDADAFFT 118 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 130 SGAIASQGNELTPTQVKDQPS-VTFEAEADAFYT 228 +GA +S + L + +D + +T +ADAF+T Sbjct: 85 AGASSSSSSSLLSSSAEDDVARITLSKDADAFFT 118 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 351 HRLRTTPGXLGSIVTSTSFINNQENWTS 434 H L T SIV++++F ++E WT+ Sbjct: 502 HTLECTSASGYSIVSTSNFNKHKEKWTA 529 Score = 23.4 bits (48), Expect = 5.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 150 LRRYSTARVFKLNVLSWSDGNDIRHYFASFECL 52 L + A V L VL+ + N+ HY EC+ Sbjct: 9 LAALTAATVLLLLVLTTTSANENTHYLPPLECV 41 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 5.8 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 347 DTSAPDHPRXTGIHRYVYILYKQPGKLDFDEKR-LTNT 457 DT+ P P T I+ +VY+ + G D+K +T T Sbjct: 80 DTNKPALPNGTIIYYWVYVQFANEGYWLTDKKHTITRT 117 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 5.8 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +2 Query: 347 DTSAPDHPRXTGIHRYVYILYKQPGKLDFDEKRLTNTSIDSRASFST 487 DT+ P P T I+ +VY+ + G D+K + + A ST Sbjct: 80 DTNKPALPNGTIIYYWVYVQFANEGYWLTDKKHTVTRTKATVAPKST 126 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 5.8 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +2 Query: 347 DTSAPDHPRXTGIHRYVYILYKQPGKLDFDEKRLTNTSIDSRASFST 487 DT+ P P T I+ +VY+ + G D+K + + A ST Sbjct: 80 DTNKPALPNGTIIYYWVYVQFANEGYWLTDKKHTVTRTKATVAPKST 126 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 23.4 bits (48), Expect = 5.8 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +2 Query: 347 DTSAPDHPRXTGIHRYVYILYKQPGKLDFDEKRLTNTSIDSRASFST 487 DT+ P P T I+ +VY+ + G D+K + + A ST Sbjct: 80 DTNKPALPNGTIIYYWVYVQFANEGYWLTDKKHTVTRTKATVAPKST 126 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 5.8 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +2 Query: 347 DTSAPDHPRXTGIHRYVYILYKQPGKLDFDEKRLTNTSIDSRASFST 487 DT+ P P T I+ +VY+ + G D+K + + A ST Sbjct: 80 DTNKPALPNGTIIYYWVYVQFANEGYWLTDKKHTVTRTKATVAPKST 126 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 5.8 Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 259 GPELVYREWHHWLVGNIPGGDLSAGETLSG-YIGSGPPQGYW 381 GP +Y+E ++G +P + + + + +IGSG P+G W Sbjct: 1775 GPSRMYQE----VLGAVPNTNKHSMKGSNPIWIGSGTPEGEW 1812 >AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CYP4H19 protein. Length = 151 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 362 PEPMYPDRVSPAERSPPGMF 303 PE P+R S A + PPG + Sbjct: 117 PERFDPERFSGANQHPPGPY 136 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 618,391 Number of Sequences: 2352 Number of extensions: 12400 Number of successful extensions: 31 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -