BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_O13 (749 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC553.01c ||SPCC736.01c|meiotic chromosome segregation protein... 27 2.9 SPAC4G8.09 |||mitochondrial leucine-tRNA ligase|Schizosaccharomy... 26 5.0 SPCC306.07c |||U3 snoRNP-associated protein Cic1/Utp30 family|Sc... 25 8.7 >SPCC553.01c ||SPCC736.01c|meiotic chromosome segregation protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 715 Score = 27.1 bits (57), Expect = 2.9 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = -3 Query: 192 RNTKARQVCIATSPLNISKFHTGTTDR 112 +N+K+R V + +SP N+ F ++D+ Sbjct: 561 KNSKSRNVSVFSSPFNVPSFTVSSSDQ 587 >SPAC4G8.09 |||mitochondrial leucine-tRNA ligase|Schizosaccharomyces pombe|chr 1|||Manual Length = 874 Score = 26.2 bits (55), Expect = 5.0 Identities = 12/49 (24%), Positives = 27/49 (55%) Frame = -1 Query: 179 QGKCVLPHHPLIYQNFIQERQIDSYLIEYPCRIELRRKVYSYSLLDFIL 33 +GK +L HH I+++ + ++ Y +L ++V +Y L D+++ Sbjct: 384 EGKELLNHHDSSNLMDIKQKMLQQKIVSYLEEKKLAKRVKNYRLKDWLI 432 >SPCC306.07c |||U3 snoRNP-associated protein Cic1/Utp30 family|Schizosaccharomyces pombe|chr 3|||Manual Length = 284 Score = 25.4 bits (53), Expect = 8.7 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = +2 Query: 134 NFDILRGDVAIHTCLAFVFLC--WSYLDSFVITTPIFKWLDIWKYEIMLAISNKRIV 298 N +L + CL F+ WS +D+ I T L IW + LA + IV Sbjct: 200 NEQLLENITTVLKCLLTNFIPKGWSAIDNVAIKTADSASLPIWTSDTNLAAHKRHIV 256 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,817,239 Number of Sequences: 5004 Number of extensions: 55727 Number of successful extensions: 117 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -