BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_O11 (774 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 25 0.51 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 6.3 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 25.4 bits (53), Expect = 0.51 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 108 LHVSSYIRMPKSNVHSTSYEASDPASNNTTYDLQL 212 L VS+ SNV + SY + D S +T YD++L Sbjct: 99 LEVSNNNFKTYSNVTTCSYYSLDDLSEDTFYDIRL 133 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 266 AFNMGVVLVSFIIFLTGNELEIIRCVIA 183 +FN L+ F++ L+GN I +I+ Sbjct: 74 SFNTFAKLLIFVVSLSGNSAVFIMLIIS 101 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,969 Number of Sequences: 336 Number of extensions: 4027 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -