BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_O11 (774 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 4.5 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 24 6.0 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 4.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 452 QKL*AVISIARRESNSLFGIMRANGINGTSAAE 354 Q++ VIS S LFG++R +NG +A + Sbjct: 1013 QRISVVISGCPSSSTLLFGLLRLPVLNGINAGK 1045 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 561 SQCGNGDEIHQAYGNFG*NRT 499 S CG E+ +AYGN RT Sbjct: 406 SGCGTQSELLRAYGNLALRRT 426 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 810,566 Number of Sequences: 2352 Number of extensions: 17389 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -