BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_O08 (717 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00036-4|AAK29850.1| 217|Caenorhabditis elegans Ribosomal prote... 93 1e-19 Z83102-9|CAI79156.1| 82|Caenorhabditis elegans Hypothetical pr... 31 0.82 >U00036-4|AAK29850.1| 217|Caenorhabditis elegans Ribosomal protein, large subunitprotein 6 protein. Length = 217 Score = 93.5 bits (222), Expect = 1e-19 Identities = 52/109 (47%), Positives = 66/109 (60%), Gaps = 1/109 (0%) Frame = +2 Query: 389 IRPNLKIGTVCILLAGRHAGKRVVLVGILP-SGLLLVTGPFAFNSCPLRRIPQRYVIGTS 565 +R L GTV I+LAGRH GKRVV + LP SGLLLVTGP N PLRRI Q +VI TS Sbjct: 67 LRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATS 126 Query: 566 TRISLGNFKLPKHFNDDYFXXXXXXXXXXXXXXEGDDIFATKKEKYVPS 712 ++++ K+P+H ND+YF G +IFA+ K +Y S Sbjct: 127 LKVNVSGVKIPEHINDEYF------KRKSTAQKTGKNIFASGKTEYTVS 169 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 125 RNYDLGNGVMRFSKSKMFHKKAKYK 199 RN+DL GV+RFS S++ KK + K Sbjct: 12 RNFDLSPGVLRFSASRLRLKKGEKK 36 >Z83102-9|CAI79156.1| 82|Caenorhabditis elegans Hypothetical protein C54C8.12 protein. Length = 82 Score = 31.1 bits (67), Expect = 0.82 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +2 Query: 320 FYPTQEKIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKR 454 FYPT+ +A S G P + PN ++ V A RHAG R Sbjct: 26 FYPTEISTKARSHGHPVNTLGESEDPNFQVDNVPGERARRHAGPR 70 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,260,208 Number of Sequences: 27780 Number of extensions: 334321 Number of successful extensions: 745 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -