BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_O07 (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyce... 28 1.1 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 26 5.9 >SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1666 Score = 28.3 bits (60), Expect = 1.1 Identities = 13/55 (23%), Positives = 29/55 (52%) Frame = +2 Query: 452 IESACHDIQYPAIAKICKDNTAHFENYIHHVLKSNTSAETMCKIVGMCNNMKLDN 616 I++AC Q+ + +IC+DN + + ++LK A+ + ++ +C+ N Sbjct: 729 IQAACLMNQFTEVERICRDNNVYNPEKVKNLLKEAKLADQL-PLILVCDRYDFVN 782 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 353 PAFVSPTQSPYSVQPRRIQPP 291 P P QSP VQP QPP Sbjct: 1031 PMAADPFQSPLYVQPTGFQPP 1051 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,868,855 Number of Sequences: 5004 Number of extensions: 60353 Number of successful extensions: 180 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 180 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -