BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_O07 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 45 7e-05 SB_11394| Best HMM Match : GntR (HMM E-Value=7.9) 32 0.50 SB_2776| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_36787| Best HMM Match : Ribosomal_S14 (HMM E-Value=3.3) 29 2.7 SB_34063| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 4.7 SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/53 (43%), Positives = 29/53 (54%) Frame = +2 Query: 182 VCLLSLTFLCCTNLSFARQVPKECAKGPQVWCESLKRGAECGAVGHCTATVWE 340 VCLL+ T T+ F P+ C GP WC SL+ EC AV HC +VW+ Sbjct: 345 VCLLAAT----THAKFVGN-PR-CVYGPAYWCRSLEHAQECDAVEHCKNSVWK 391 >SB_11394| Best HMM Match : GntR (HMM E-Value=7.9) Length = 451 Score = 31.9 bits (69), Expect = 0.50 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 641 CFSCSTK*Y-CPISCCYTCRRFCTLSRPMCSI*ERDVCNFRNGPCCLC 501 C+SC Y C ++CC +CR C R C R VC CC C Sbjct: 220 CYSCRVVCYSCRVACC-SCRVVCYSCRVACCS-CRVVCYSCRVACCSC 265 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 641 CFSCSTK*Y-CPISCCYTCRRFCTLSRPMCSI*ERDVCNFRNGPCCLC 501 C SC Y C ++CC +CR C R +C R VC CC C Sbjct: 150 CCSCRVVCYSCRVACC-SCRVACCSCRVVCYS-CRVVCYSCRVACCSC 195 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = -3 Query: 641 CFSCSTK*YCPISCCYTCRRFCTLSRPMCSI*ERDVCNFRNGPCCLC 501 C SC Y CY+CR C R +C C+ R CC C Sbjct: 171 CCSCRVVCYSCRVVCYSCRVACCSCRVVCYSCRVVFCSCRVA-CCSC 216 >SB_2776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1792 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/59 (22%), Positives = 28/59 (47%), Gaps = 3/59 (5%) Frame = +1 Query: 490 REDMQRQHGPFRKLHTSRSQIEHIGRDNV---QNRRHV*QHEIGQYYFVEQEKHQRARQ 657 R+ + H P R++HTS + + + + +H +H+ GQ+ + H+ +Q Sbjct: 451 RKSSAKYHEPLRRIHTSHKDLAALAKKESRKHKKHKHKHEHKEGQHKGSHRSSHRSEKQ 509 >SB_36787| Best HMM Match : Ribosomal_S14 (HMM E-Value=3.3) Length = 280 Score = 29.5 bits (63), Expect = 2.7 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 3/92 (3%) Frame = -2 Query: 477 WISWHADSM-LAARYSSLIRSLTSLSPRN-SFTNF-DDISLSETSGFCFSHTVAVQCPTA 307 W+ H DS +AA +R + N N+ DD ++SET S + Sbjct: 34 WLKPHIDSNNVAASGLKYLRDRELIDHDNMELWNYVDDTTISETIARESSSNIQAAVDAL 93 Query: 306 PHSAPRFRLSHHTCGPLAHSFGTCRANDKFVQ 211 SA +F+L+ C L F T +N + +Q Sbjct: 94 SASADKFKLNERKCKELRIGFSTKPSNFEPIQ 125 >SB_34063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 886 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 533 IHHVLKSNTSAETMCKIVGMCNNMKLDNIISLNKKSTNV 649 IHHV+ ++ SA+ I + K+D+I+S +K ++ Sbjct: 211 IHHVIANDISADAFSLIENNVKHNKVDHIVSASKNDASL 249 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 201 RSFVVQICRLRDKYRRNVLRDHKYG 275 R +V +C RD RNV RDH G Sbjct: 17 RKIMVMVCHGRDNGHRNVTRDHGNG 41 >SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1332 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -2 Query: 315 PTAPHSAPRFRLSHHTCGPLAHSFGTCRANDKFVQQRNVRDSRQT 181 P H F + ++ P+ CRANDK V+ ++ R S ++ Sbjct: 121 PQHLHRTYNFSMMNNVRQPIPVLVNNCRANDKLVESQSKRKSARS 165 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,933,660 Number of Sequences: 59808 Number of extensions: 477947 Number of successful extensions: 1459 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1449 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -