BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_O05 (764 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 25 3.4 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 25 3.4 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 24 4.5 DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 24 5.9 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 24 5.9 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 23 7.8 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +2 Query: 566 IHRKHTKMLLKSARRK-CSPH 625 + +KHTK LLK+ K C H Sbjct: 329 VRKKHTKKLLKTTHEKSCGSH 349 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +2 Query: 566 IHRKHTKMLLKSARRK-CSPH 625 + +KHTK LLK+ K C H Sbjct: 329 VRKKHTKKLLKTTHEKSCGSH 349 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 24.2 bits (50), Expect = 4.5 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = +1 Query: 310 WRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKV 483 W+V+ ++ + K + + +V K C V L+D LI K NP+ V Sbjct: 274 WKVMKDVKDFIKLLLHKAFIVENQPPQVMKMNTRFCASVRLLIDNALIMKIGNPKVTV 331 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 23.8 bits (49), Expect = 5.9 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +3 Query: 198 HGGRDEGSDGNRRRT*QRGEEPPFSC 275 HGG D D + EE PF C Sbjct: 222 HGGDDSDGDDTKYEIHSDDEELPFKC 247 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 23.8 bits (49), Expect = 5.9 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +3 Query: 198 HGGRDEGSDGNRRRT*QRGEEPPFSC 275 HGG D D + EE PF C Sbjct: 222 HGGDDSDGDDTKYEIHSDDEELPFKC 247 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 23.4 bits (48), Expect = 7.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 122 RPRCPSTRKNWCNVP 166 RPR PS R N N+P Sbjct: 126 RPRTPSMRVNCTNIP 140 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 791,657 Number of Sequences: 2352 Number of extensions: 16601 Number of successful extensions: 38 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -