BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_O02 (708 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69979-1|CAA93819.1| 127|Anopheles gambiae vacuolar ATPase prot... 213 5e-57 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 9.4 >Z69979-1|CAA93819.1| 127|Anopheles gambiae vacuolar ATPase protein. Length = 127 Score = 213 bits (520), Expect = 5e-57 Identities = 97/122 (79%), Positives = 110/122 (90%) Frame = +3 Query: 54 ALHAAVKGKLISVIGDEDTCVGFLLGGIGEINKNRHPNFMVVDKNTPVSEIEECFKRFVK 233 AL +A+KGKLISVIG EDTCVGFLLGG+GEINKNRHPNFMVVDKNT VSEIE+CFKRF+K Sbjct: 2 ALLSAMKGKLISVIGHEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVSEIEDCFKRFIK 61 Query: 234 RXXXXXXLINQNIAELIRHVIDAHSAPVPSVLEIPSKDHPYDASKDSILRRAKGMFNPDD 413 R +INQN AELIRHVID+H+AP P+ +EIPSKDHPYDASKDSILRRAKGMFNP+D Sbjct: 62 RDDIDIIVINQNYAELIRHVIDSHTAPTPADVEIPSKDHPYDASKDSILRRAKGMFNPED 121 Query: 414 LV 419 ++ Sbjct: 122 MI 123 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 9.4 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -2 Query: 449 SKTCNILALAYQVVWV 402 S C + +AYQV+W+ Sbjct: 1899 SDGCAVYEVAYQVIWI 1914 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 710,848 Number of Sequences: 2352 Number of extensions: 14348 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -