SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_F_N24
         (453 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_0238 - 1976645-1977561,1977649-1977909,1978243-1978275,198...    31   0.57 

>01_01_0238 -
           1976645-1977561,1977649-1977909,1978243-1978275,
           1980556-1981345
          Length = 666

 Score = 30.7 bits (66), Expect = 0.57
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 7/57 (12%)
 Frame = -1

Query: 414 RNSLFFISLDGIIYESNSILLKSEYSYLQYH*CPI-DFSVISGL------LSSSNKY 265
           R+ LF +  D I YE+NS++   E ++     CP+ DF+V S L      +S++NKY
Sbjct: 80  RDHLFRV--DSIFYENNSLVAAVETTFAGDADCPVPDFNVTSSLSPYPFIISNTNKY 134


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,004,462
Number of Sequences: 37544
Number of extensions: 64292
Number of successful extensions: 103
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 103
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 103
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 883560296
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -