BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_N22 (611 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 67 1e-13 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 24 1.0 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.4 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.1 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 4.1 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.2 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 9.5 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 9.5 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 9.5 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 9.5 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 66.9 bits (156), Expect = 1e-13 Identities = 41/166 (24%), Positives = 67/166 (40%), Gaps = 1/166 (0%) Frame = +1 Query: 109 MGCGTSFVKYXXXXXXXXXXXXXXXXXXXXXXXXMNWTMVKDLLKTHLAVGPWIFIVVGA 288 M CG +KY + V ++T LA IV+G+ Sbjct: 1 MSCGMGMIKYLLFIFNFVFAVCGLGILTLGVLIHLQILGVSKQIETGLAFPSITLIVLGS 60 Query: 289 VMFVIAFLGCCGAIRESHCMVVTYAXXXXXXXXXXXXXXXXXFTYGESIKESIMDGVGVL 468 ++FVI+F GCCGAIRESHCM +T+A F ++ + + Sbjct: 61 IIFVISFFGCCGAIRESHCMTITFASFLLFILLVQIAVAVYAFIVVKN--DDNFRNISEK 118 Query: 469 FKKRSDANADEAAEAVFSE-LQRQFECCGNTGAINYGQFTLPESCC 603 +++ + + F + +Q+ +CCG +Y +P SCC Sbjct: 119 YQEIFNGYFLNSESKDFIDFIQKNLQCCGVHSLSDYNDKPIPASCC 164 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 24.2 bits (50), Expect = 1.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 472 KKRSDANADEAAEAVFSELQRQ 537 +KR DA DE+ EA+F + RQ Sbjct: 292 EKRDDAK-DESVEAIFQSILRQ 312 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 436 KESIMDGVGVLFKKRSDANADEAAEAVFSELQR 534 K S+M G+ + + DE VFS LQR Sbjct: 96 KRSLMGAQGLSIRGLQINHEDETIRPVFSTLQR 128 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +3 Query: 366 LFAGDHHCASGDQRPPLHLRREHQGEHYGWRRR 464 L+ + DQ+P +L + + YG RR+ Sbjct: 963 LYKSSESSCNPDQKPTEYLLEDSMKQQYGKRRK 995 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.2 bits (45), Expect = 4.1 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = -3 Query: 510 LGGLVCVSVRSLFE*HADAIHNALLDALAVGEEEDADHHLHNDDHQQKDCVRDDHAVTLA 331 L GL ++ R LF +H+A D + VGE+ A L + K + + + A Sbjct: 397 LNGLEGLTGRGLFISDIP-LHDATRDVILVGEQARAQDGLRRRMDKLKSSIEEANLAVSA 455 Query: 330 YR 325 R Sbjct: 456 ER 457 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 145 IAHISQNSFHIPC*EHYFLFLFHN 74 I + S +SF+IPC +FL++N Sbjct: 344 IIYSSLSSFYIPC--IIMVFLYYN 365 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/19 (47%), Positives = 10/19 (52%), Gaps = 1/19 (5%) Frame = -3 Query: 399 HHLHNDDHQ-QKDCVRDDH 346 HHL N H Q V+D H Sbjct: 142 HHLQNHHHHLQSTAVQDHH 160 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +3 Query: 399 DQRPPLHLRREHQGEHYGWR 458 D RP + + G H+G R Sbjct: 368 DSRPQYQIDKRSMGSHHGQR 387 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 94 FLFLFHNKHFT 62 F FL+ NKHFT Sbjct: 202 FGFLYLNKHFT 212 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 342 LHGRHVRNLFAGDHHCAS 395 LH ++N+ DHH AS Sbjct: 349 LHSFQMKNVTIVDHHTAS 366 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 94 FLFLFHNKHFT 62 F FL+ NKHFT Sbjct: 202 FGFLYLNKHFT 212 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,192 Number of Sequences: 438 Number of extensions: 3161 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -