BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_N15 (579 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 5.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 5.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 5.7 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/30 (30%), Positives = 12/30 (40%) Frame = -1 Query: 120 FWPP*XPXXRGTQKEQHGFVWAATDLKAAW 31 F PP + QH ++W L AW Sbjct: 201 FVPPPLMFLQDFLSHQHAWIWLVWLLSQAW 230 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/30 (30%), Positives = 12/30 (40%) Frame = -1 Query: 120 FWPP*XPXXRGTQKEQHGFVWAATDLKAAW 31 F PP + QH ++W L AW Sbjct: 434 FVPPPLMFLQDFLSHQHAWIWLVWLLSQAW 463 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/30 (30%), Positives = 12/30 (40%) Frame = -1 Query: 120 FWPP*XPXXRGTQKEQHGFVWAATDLKAAW 31 F PP + QH ++W L AW Sbjct: 434 FVPPPLMFLQDFLSHQHAWIWLVWLLSQAW 463 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,380 Number of Sequences: 336 Number of extensions: 2150 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -