BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_N08 (689 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 675 INKVFD*NTFNYNRYKTMISSTNF*TLTKKNSR 577 +NK F+ + +++ R + N T NSR Sbjct: 1525 VNKAFEEDNYDHRRNSLQMQQRNNVTWKSSNSR 1557 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 675 INKVFD*NTFNYNRYKTMISSTNF*TLTKKNSR 577 +NK F+ + +++ R + N T NSR Sbjct: 1525 VNKAFEEDNYDHRRNSLQMQQRNNVTWKSSNSR 1557 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 675 INKVFD*NTFNYNRYKTMISSTNF*TLTKKNSR 577 +NK F+ + +++ R + N T NSR Sbjct: 1525 VNKAFEEDNYDHRRNSLQMQQRNNVTWKSSNSR 1557 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 675 INKVFD*NTFNYNRYKTMISSTNF*TLTKKNSR 577 +NK F+ + +++ R + N T NSR Sbjct: 1525 VNKAFEEDNYDHRRNSLQMQQRNNVTWKSSNSR 1557 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,819 Number of Sequences: 336 Number of extensions: 1940 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -