BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_M23 (541 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6X8H4 Cluster: Putative uncharacterized protein; n=1; ... 35 1.0 UniRef50_A2Q1T0 Cluster: Putative uncharacterized protein; n=1; ... 33 5.6 UniRef50_A7K807 Cluster: Putative uncharacterized protein z047R;... 32 9.7 UniRef50_Q4GYE3 Cluster: Putative uncharacterized protein; n=1; ... 32 9.7 >UniRef50_A6X8H4 Cluster: Putative uncharacterized protein; n=1; Ochrobactrum anthropi ATCC 49188|Rep: Putative uncharacterized protein - Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) Length = 1112 Score = 35.1 bits (77), Expect = 1.0 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +1 Query: 274 PPSTTTVDTLDLRQML*YIFLINSGDAPQFSESCIFY 384 PPS TVD D Q++ ++F + S +APQ ++S ++Y Sbjct: 752 PPSGQTVDPTDNSQIITFVFRLLSNNAPQQNQSILWY 788 >UniRef50_A2Q1T0 Cluster: Putative uncharacterized protein; n=1; Medicago truncatula|Rep: Putative uncharacterized protein - Medicago truncatula (Barrel medic) Length = 469 Score = 32.7 bits (71), Expect = 5.6 Identities = 18/51 (35%), Positives = 30/51 (58%) Frame = +1 Query: 40 DKTVSWSRSSTNVSIYYNIV*FIVSEYYC*LNRLTLFVENLVPTNLIKQIN 192 D +S+ RSS+ + +Y N FI +YY L L FV+N+ P N++ ++ Sbjct: 292 DPIISYLRSSSQLKVYMNF--FI--DYYHHLCNLREFVQNIKPQNVLSSLS 338 >UniRef50_A7K807 Cluster: Putative uncharacterized protein z047R; n=3; Chlorovirus|Rep: Putative uncharacterized protein z047R - Chlorella virus ATCV-1 Length = 260 Score = 31.9 bits (69), Expect = 9.7 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = -2 Query: 516 SQLFYLQIFITTYILCVSLVVCSCQIAYSKNLISSL 409 S FY++ +Y+ C+SLV C ++ +++N + L Sbjct: 13 SSCFYIKEIFLSYLRCLSLVPCGPRVIFAENFVGCL 48 >UniRef50_Q4GYE3 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 128 Score = 31.9 bits (69), Expect = 9.7 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +2 Query: 218 YIYK*MCECECECVSLCASRPQLRQ*ILWISDKCCSIYF-*LIRVMRLSFQNHVFF 382 YI +C C C CV +C RP I + CCS +F ++R F + +F+ Sbjct: 2 YICFCLCLCLCLCVYMCNHRP-----IFFFVHPCCSFHFSPPFALLRFRFLSFIFY 52 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 434,343,897 Number of Sequences: 1657284 Number of extensions: 7483091 Number of successful extensions: 13654 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13600 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 34572633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -