BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_M23 (541 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49058| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 >SB_49058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 519 KSQLFYLQIFITTYILCVSLVVCSCQIAYS 430 K QL+Y+ T +LC L CSC ++Y+ Sbjct: 223 KVQLYYVLYLQGTVVLCPILTRCSCTMSYT 252 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 519 KSQLFYLQIFITTYILCVSLVVCSCQIAYS 430 K QL+Y+ +LC L CSC ++Y+ Sbjct: 37 KVQLYYVLYLQGAVVLCPILTRCSCTMSYT 66 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 519 KSQLFYLQIFITTYILCVSLVVCSCQIAYS 430 K QL+Y+ +LC L CSC ++Y+ Sbjct: 68 KVQLYYVLYLQGAVVLCPILTRCSCTMSYT 97 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 519 KSQLFYLQIFITTYILCVSLVVCSCQIAYS 430 K QL+Y+ +LC L CSC +Y+ Sbjct: 192 KVQLYYVMYLQGAVVLCPILTRCSCTTSYT 221 Score = 27.1 bits (57), Expect = 9.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 519 KSQLFYLQIFITTYILCVSLVVCSCQIAYS 430 K QL+Y+ +LC L CSC ++Y+ Sbjct: 6 KVQLYYVLYLQGAVVLCHILTRCSCTMSYT 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,596,238 Number of Sequences: 59808 Number of extensions: 243442 Number of successful extensions: 365 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -