BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_M23 (541 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41264-9|AAA82429.3| 240|Caenorhabditis elegans Hypothetical pr... 27 8.6 >U41264-9|AAA82429.3| 240|Caenorhabditis elegans Hypothetical protein F10E7.2 protein. Length = 240 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -2 Query: 495 IFITTYILCVSLVVCSCQIAYSKNLISSLFNGRNNYFV 382 +F+TTY LC++L++ I S +LI + N +FV Sbjct: 203 VFLTTYCLCLTLIL-KRSIRLSNHLIFKKVHCFNLFFV 239 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,455,132 Number of Sequences: 27780 Number of extensions: 196477 Number of successful extensions: 370 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 370 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1081316076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -