BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_M20 (460 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 23 1.0 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 1.4 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 1.4 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 1.4 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 1.4 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 1.4 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 1.4 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 1.4 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 1.4 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 1.4 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 1.4 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 23 1.8 AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 20 9.6 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 23.4 bits (48), Expect = 1.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 108 GLLSAFVHLLHCTSEHGFQAPIHP 37 GLLSA+ LLH S+ P P Sbjct: 421 GLLSAYGELLHALSDKPELRPFEP 444 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +3 Query: 186 ATTPAREESRASTPASSTQVKESDSTPAPAKTTKTQSKDT 305 +TTP E +R + S+ K +TP P + +S T Sbjct: 405 STTPRPEWARPPSTPSADGSKPVQTTPKPGQWVPEKSTST 444 Score = 22.2 bits (45), Expect = 2.4 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 Query: 18 AGWNKNWDE 44 +GW K WDE Sbjct: 321 SGWTKKWDE 329 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 189 TTPAREESRASTPASSTQVKESDSTPAPAKTTKTQSKDTPADSGS 323 +TP+ + S+ +S + PA +T +Q+ +PA S S Sbjct: 130 STPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPASSTS 174 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 189 TTPAREESRASTPASSTQVKESDSTPAPAKTTKTQSKDTPADSGS 323 +TP+ + S+ +S + PA +T +Q+ +PA S S Sbjct: 130 STPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 174 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 189 TTPAREESRASTPASSTQVKESDSTPAPAKTTKTQSKDTPADSGS 323 +TP+ + S+ +S + PA +T +Q+ +PA S S Sbjct: 130 STPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 174 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 189 TTPAREESRASTPASSTQVKESDSTPAPAKTTKTQSKDTPADSGS 323 +TP+ + S+ +S + PA +T +Q+ +PA S S Sbjct: 130 STPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 174 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 189 TTPAREESRASTPASSTQVKESDSTPAPAKTTKTQSKDTPADSGS 323 +TP+ + S+ +S + PA +T +Q+ +PA S S Sbjct: 130 STPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 174 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 189 TTPAREESRASTPASSTQVKESDSTPAPAKTTKTQSKDTPADSGS 323 +TP+ + S+ +S + PA +T +Q+ +PA S S Sbjct: 86 STPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 130 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 189 TTPAREESRASTPASSTQVKESDSTPAPAKTTKTQSKDTPADSGS 323 +TP+ + S+ +S + PA +T +Q+ +PA S S Sbjct: 130 STPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 174 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 1.4 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 192 TPAREESRASTPASSTQVKESDSTPAPAKTTKTQSKDTPADSGS 323 +P A+TP SS+ + + P PA TT + S + A + S Sbjct: 10 SPPPAPQSAATPISSSGMTSPAAAPPPA-TTSSGSPASVASNAS 52 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 1.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 189 TTPAREESRASTPASSTQVKESDSTPAPAKTTKTQSKDTPADSGS 323 +TP+ + S+ +S + PA +T +Q+ +PA S S Sbjct: 130 STPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTS 174 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 22.6 bits (46), Expect = 1.8 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 78 HCTSEHGFQAPIHPNFC 28 HC +HG+ A P+ C Sbjct: 106 HCPRKHGYFAHEEPHIC 122 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 20.2 bits (40), Expect = 9.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 108 GLLSAFVHLLHC 73 G+ S+FVH HC Sbjct: 29 GINSSFVHKEHC 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,819 Number of Sequences: 336 Number of extensions: 1454 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10511300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -