BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_M19 (603 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) 152 2e-37 SB_55396| Best HMM Match : Sod_Cu (HMM E-Value=1.5e-07) 66 3e-11 SB_580| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_24828| Best HMM Match : Peptidase_A17 (HMM E-Value=1.7e-23) 39 0.004 SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13) 31 0.72 SB_14385| Best HMM Match : ANF_receptor (HMM E-Value=6.5e-35) 31 0.95 SB_51387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_50931| Best HMM Match : Extensin_2 (HMM E-Value=0.14) 29 2.9 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 29 3.8 SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_58981| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_41181| Best HMM Match : DUF164 (HMM E-Value=2.1) 28 5.1 SB_4095| Best HMM Match : LRR_adjacent (HMM E-Value=2) 28 5.1 SB_55031| Best HMM Match : GRP (HMM E-Value=5.3) 28 5.1 SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) 28 6.7 SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_2229| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-25) 27 8.8 >SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 152 bits (369), Expect = 2e-37 Identities = 66/121 (54%), Positives = 86/121 (71%) Frame = +1 Query: 184 VQGGITGLPPGEYGFHVHEKGDLSGGCVSTGSHFNPEHKDHGHPNDVNRHVGDLGNVVFD 363 + G I GL G +GFH+H GD + GCVS G HFNP K+HG P+D NRHVGDLGNVV Sbjct: 30 ITGTIEGLKAGNHGFHIHVYGDNTNGCVSAGPHFNPFKKEHGGPSDENRHVGDLGNVVAG 89 Query: 364 ENHYSRIDLVDDQISLSGPHGIIGRAVVLHEKADDYGKSDHPDSRKTGNAGGRVACGVIG 543 ++ + ID+ D ++L G H ++GR+VV+H DD G+ H DS+ TG+AGGR+ACGVIG Sbjct: 90 DDGKACIDMTDALVTLVGEHSVVGRSVVVHADEDDLGRGGHEDSKTTGHAGGRLACGVIG 149 Query: 544 I 546 I Sbjct: 150 I 150 >SB_55396| Best HMM Match : Sod_Cu (HMM E-Value=1.5e-07) Length = 100 Score = 65.7 bits (153), Expect = 3e-11 Identities = 30/70 (42%), Positives = 43/70 (61%) Frame = +1 Query: 331 HVGDLGNVVFDENHYSRIDLVDDQISLSGPHGIIGRAVVLHEKADDYGKSDHPDSRKTGN 510 HVGDLGN++ ++N + D + + IIGRA+V+H DD G+ H S+ TGN Sbjct: 1 HVGDLGNIIANQNGRATFRFEDKTVKV---WDIIGRAIVVHADEDDLGRGGHELSKSTGN 57 Query: 511 AGGRVACGVI 540 +G RV CG+I Sbjct: 58 SGARVGCGII 67 >SB_580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 51.2 bits (117), Expect = 6e-07 Identities = 22/48 (45%), Positives = 32/48 (66%) Frame = +1 Query: 304 HGHPNDVNRHVGDLGNVVFDENHYSRIDLVDDQISLSGPHGIIGRAVV 447 HG P D +RH+GDLGN+ D N + + + D +SL+G IIGR++V Sbjct: 2 HGAPEDKDRHLGDLGNIEADANGIADVSITDCLVSLTGQCSIIGRSLV 49 >SB_24828| Best HMM Match : Peptidase_A17 (HMM E-Value=1.7e-23) Length = 1531 Score = 38.7 bits (86), Expect = 0.004 Identities = 37/125 (29%), Positives = 61/125 (48%), Gaps = 13/125 (10%) Frame = +1 Query: 115 AVLSTETIRGNITFTQVQ-DGKVHVQGGITGLPPGEYGFHVHE-----KGDLSGGC--VS 270 A S IRG +TFTQ + +++ +TG+ + +H+ KG+ + C V+ Sbjct: 59 ATFSMSGIRGTVTFTQSSPNTSTNIKLALTGVNE-TLSWQIHDLPVIYKGNAATTCNTVA 117 Query: 271 TGSHFNPEHKDHGHPNDVNRH---VGDL-GNVVF-DENHYSRIDLVDDQISLSGPHGIIG 435 G+ ++P+ + + VGDL G F D N+ S + D + L+G HGI G Sbjct: 118 LGNLYDPDGTATAQCSAAQKKSCAVGDLRGKFGFIDGNNMSSV-FHDSNLPLTGRHGIFG 176 Query: 436 RAVVL 450 R +VL Sbjct: 177 RTLVL 181 >SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13) Length = 969 Score = 31.1 bits (67), Expect = 0.72 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 6/103 (5%) Frame = +1 Query: 238 EKGDLSGGCVSTGSHFNPEHKDHGHPNDVNRHVGDLGNVVFDE---NHYSRIDLVD-DQI 405 ++ DL S H N +D GH ++ + D N DE +H S D++D + + Sbjct: 204 QRSDLIHSSQSEAVHRNVHAEDEGHIDEYGCGLHD--NEQLDEEVASHVSGDDIMDVNDL 261 Query: 406 SLSGPHGIIGRAVVLHEKA--DDYGKSDHPDSRKTGNAGGRVA 528 S + R V +K D+YG H D + G A V+ Sbjct: 262 IHSSQSEAVHRNVHAEDKGHIDEYGCGLHNDEQSDGEAASHVS 304 >SB_14385| Best HMM Match : ANF_receptor (HMM E-Value=6.5e-35) Length = 1003 Score = 30.7 bits (66), Expect = 0.95 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 127 TETIRGNITFTQVQDGKVHVQGGITGLPPGEYGFHVHEKGDLSGGCVSTGSH 282 +E + N T DG+V V+ +TG G + E+ DL+ G ++ SH Sbjct: 395 SEILHFNYTIYMSPDGRVGVENPVTGNWDGVINELIQERADLAVGPITITSH 446 >SB_51387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 367 NHYSRIDLVDDQISLSGPHGIIG-RAVVLHEKADDYGKSDHP 489 NH+S L + +L GP+ G R +++++K D Y K D P Sbjct: 111 NHHSTGILKCQRANLKGPNLCAGKRRILIYDKYDKYDKYDFP 152 >SB_50931| Best HMM Match : Extensin_2 (HMM E-Value=0.14) Length = 348 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 202 GLPPGEYGFHVHEKGDLSGGCVSTGSHFNPEHKDHGHPNDV 324 GLPPG G +V + G + G+H + +H PN+V Sbjct: 307 GLPPGNPGQYVTPQ-PRHAGLLENGNHVSEQHNKQTPPNNV 346 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 29.1 bits (62), Expect = 2.9 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 303 PRSSERCQPSRRRPWKRG-L*REPLQQDRPG-RRPDLAIGSARHHRQGGGAP 452 PRS ER RP +RG R P +++R G RRP A +R + G P Sbjct: 621 PRSRERSDRRDERPQRRGSRGRSPGRREREGERRPRSAERQSRRQDEPKGEP 672 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +3 Query: 15 SQRENKNAASTNIPGRDRSGDGSSRLHHAVSRHCRSIHRND*RQHHVH 158 S + K A GR R G S+ HH ++H R RN +HH H Sbjct: 314 SVNQIKTANKHETFGRQRHGLRQSKKHHR-NKHYRHHDRNHHHRHHHH 360 >SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3133 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +2 Query: 53 SWPRSLWRRLIT---ASPRRLAPLPFYPQ-KRLEATSRSPR 163 ++PRSLWRRL+ R P P P +R E SR+ R Sbjct: 428 AYPRSLWRRLLVDLRGIVERGTPSPVQPMLRRFELASRALR 468 >SB_58981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 794 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 274 GSHFNPEHKDHGHPNDVNRHVGDLGNVVFDENHYSRIDLVDDQIS 408 G+H N H HP++V+ L V +N S + D+Q S Sbjct: 617 GNHLNTVHTPDNHPSNVHTPDNHLNTVHTPDNQPSTVHTPDNQPS 661 >SB_41181| Best HMM Match : DUF164 (HMM E-Value=2.1) Length = 258 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 157 TQVQDGKVHVQGGITGLPPGEYGFHVHEKGDLSGGCVS 270 T V +G +HVQ +T +P G E D+ GC++ Sbjct: 58 TDVPEGSIHVQEEMTDVPKGSINVQ-EEITDVPEGCIN 94 >SB_4095| Best HMM Match : LRR_adjacent (HMM E-Value=2) Length = 113 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 125 PQKRLEATSRSPRFKMGRSTFRGVSLGCLRVNMAF 229 PQK SR P+ +G++ FRG L L N+ F Sbjct: 48 PQKSGTQLSRVPKVAIGKTQFRGKVLTSLEDNVGF 82 >SB_55031| Best HMM Match : GRP (HMM E-Value=5.3) Length = 487 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = -3 Query: 595 YILLNKTSKCEICRSIEFR*HRKRLDRQRCRSSWSPDGHSCHNHQL 458 +ILL C R R HR+RL RQRC ++ D + H L Sbjct: 111 HILLRLHPAC--IRGFCLRHHRQRLPRQRCFGIFTTDYSNAHKRVL 154 >SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 127 WIERQWRETAW*SRDEPSPERS 62 W ER W T W R +P+RS Sbjct: 123 WFERGWSGTTWPGRKAGNPQRS 144 >SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) Length = 391 Score = 27.9 bits (59), Expect = 6.7 Identities = 23/62 (37%), Positives = 27/62 (43%) Frame = +1 Query: 187 QGGITGLPPGEYGFHVHEKGDLSGGCVSTGSHFNPEHKDHGHPNDVNRHVGDLGNVVFDE 366 Q G TG PPGEYG++ G G G H P K P D N ++ G D Sbjct: 91 QKGPTG-PPGEYGYNGF-PGSRHGQSGFPGLHGPPGPKG---PAD-NPYITTSGQQALDN 144 Query: 367 NH 372 NH Sbjct: 145 NH 146 >SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1894 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +3 Query: 303 PRSSERCQPSRRRPWKRGL*REPLQQDRPGRRPDLAIGSARHHRQ 437 P+ R R+P++ G ++P Q RPG++P + H+Q Sbjct: 556 PQQPFRADQQNRQPFQSG--QQPQQAFRPGQQPQQPSRPGQQHQQ 598 >SB_2229| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-25) Length = 419 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +1 Query: 229 HVHEKGDLSGGCVSTGSHFNPEHKDHGHPNDVNRHVGDLGNVVFDENHYSRID 387 +V DL G + G+H HG+ ND+N V N + E++ + D Sbjct: 348 NVPSVADLPNGQLHHGNHNINGPLFHGNNNDLNGQVSQRNNYNYSEDYLHQCD 400 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,732,086 Number of Sequences: 59808 Number of extensions: 478602 Number of successful extensions: 1744 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1736 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -