BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_M17 (409 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43242| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_30032| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) 28 3.4 SB_5207| Best HMM Match : TUDOR (HMM E-Value=3.1) 27 5.9 SB_5031| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_17184| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 >SB_43242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 45.2 bits (102), Expect = 2e-05 Identities = 22/47 (46%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +2 Query: 170 HWSVKAXXXXXXXXXXMRHLKIVRRRFRNGFKEG-KPTPPKKAVASS 307 +WS+KA MRHLK+V RRF+NGF+EG + KK VA++ Sbjct: 2 NWSMKAKRRTTTGTGRMRHLKLVYRRFQNGFQEGTQAKSQKKNVAAA 48 >SB_30032| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) Length = 819 Score = 27.9 bits (59), Expect = 3.4 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 113 CDMTIYHIFCITYGSYFGA 57 CD +IYHI+ + Y ++GA Sbjct: 355 CDSSIYHIYRLKYAVHYGA 373 >SB_5207| Best HMM Match : TUDOR (HMM E-Value=3.1) Length = 364 Score = 27.1 bits (57), Expect = 5.9 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +1 Query: 139 WISCSKITILPLVSEG*AQEDYWNWPHASF 228 W++C K+ +LP+ ++ Y W + F Sbjct: 136 WVNCDKVRLLPMRADEVGARVYARWTNGQF 165 >SB_5031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 27.1 bits (57), Expect = 5.9 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +1 Query: 139 WISCSKITILPLVSEG*AQEDYWNWPHASF 228 W++C K+ +LP+ ++ Y W + F Sbjct: 297 WVNCDKVRLLPMRADEVGARVYARWTNGQF 326 >SB_17184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 26.6 bits (56), Expect = 7.8 Identities = 19/74 (25%), Positives = 29/74 (39%), Gaps = 1/74 (1%) Frame = +2 Query: 53 GKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMR-HL 229 G R KT +R R + QK CGY + RSY S + R + Sbjct: 31 GAARAKTLAEKQRRNRLATAAQKCSTFTCGYKRSYKRSYKRSYERSYKRGYERSYKRGYK 90 Query: 230 KIVRRRFRNGFKEG 271 + R ++ G++ G Sbjct: 91 RSYERSYKRGYERG 104 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,458,308 Number of Sequences: 59808 Number of extensions: 194432 Number of successful extensions: 766 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 766 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -