BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_M13 (640 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25B8.07c |||hypoxia induced family protein|Schizosaccharomyc... 54 1e-08 SPCC1672.06c |asp1|vip1|inositol hexakisphosphate kinase/inosito... 29 0.75 SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3 |Schizosaccha... 28 1.3 SPBC409.08 |||spermine family transporter |Schizosaccharomyces p... 26 4.0 >SPAC25B8.07c |||hypoxia induced family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 54.4 bits (125), Expect = 1e-08 Identities = 26/71 (36%), Positives = 37/71 (52%) Frame = +3 Query: 294 ASHHVETTREKFHRKFTENPFVPLGCLATAGALSMGLWSFRTGKTRLSQQMMRVRILAQG 473 AS + EK F NPF+PLGCL T G + R ++ + MR R+++QG Sbjct: 20 ASEESLSRSEKLKYVFVRNPFIPLGCLMTVGTFLASGYYIRRENHLMANKFMRYRVMSQG 79 Query: 474 LTIAALVIGVV 506 T+AAL V+ Sbjct: 80 FTLAALAFSVL 90 >SPCC1672.06c |asp1|vip1|inositol hexakisphosphate kinase/inositol pyrophosphate synthase |Schizosaccharomyces pombe|chr 3|||Manual Length = 920 Score = 28.7 bits (61), Expect = 0.75 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 246 PEPTDLHWVQLRKEMGASHHVETT-REKFHRKFTENPFVPL 365 P P + +L+ +G H + T ++KF FT +PFV L Sbjct: 378 PPPRESEAWRLKSLVGVLRHADRTPKQKFKFSFTSDPFVKL 418 >SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 578 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -3 Query: 635 ISNHLLTCTIISLKKNIYLLSFLISLI 555 I N+ L T+ISLK+N++L F ++ + Sbjct: 16 IDNNYLVTTLISLKENVFLHIFTLTFL 42 >SPBC409.08 |||spermine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 539 Score = 26.2 bits (55), Expect = 4.0 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -2 Query: 327 IFLLSFLHDEKLPFPCAVAPNVNPLVLVQLTFSSF 223 ++L++ + L PCA+APN+ L++V+ F Sbjct: 169 VYLVTLMIYIVLQIPCALAPNIACLLIVRFFCGCF 203 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,361,047 Number of Sequences: 5004 Number of extensions: 45194 Number of successful extensions: 97 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -