BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_M13 (640 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0124 + 12526572-12526689,12528205-12528392 67 1e-11 07_01_0129 - 959600-959625,960100-961428,961585-961657,962185-96... 27 9.5 >09_03_0124 + 12526572-12526689,12528205-12528392 Length = 101 Score = 66.9 bits (156), Expect = 1e-11 Identities = 33/66 (50%), Positives = 45/66 (68%) Frame = +3 Query: 333 RKFTENPFVPLGCLATAGALSMGLWSFRTGKTRLSQQMMRVRILAQGLTIAALVIGVVIT 512 +K +NPFVP+G L TAG L+ GL SFR G ++L Q++MR R++AQG T+ AL+IG Sbjct: 29 KKPVKNPFVPIGALVTAGVLTAGLISFRYGNSKLGQKLMRARVVAQGATV-ALMIGSAYY 87 Query: 513 TGKSSK 530 G K Sbjct: 88 YGDQIK 93 >07_01_0129 - 959600-959625,960100-961428,961585-961657,962185-962226 Length = 489 Score = 27.5 bits (58), Expect = 9.5 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -3 Query: 485 SNGKPLCKNSHSHHLLRESCLSSSKTPKTH 396 +N LC+ +S HLL ++CL S + + H Sbjct: 178 NNCPRLCRQPYSMHLLLDNCLFSRQLEREH 207 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,158,573 Number of Sequences: 37544 Number of extensions: 253161 Number of successful extensions: 499 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 499 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -