Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_F_M13
         (640 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g48030.1 68416.m05236 hypoxia-responsive family protein / zin...    62   3e-10

>At3g48030.1 68416.m05236 hypoxia-responsive family protein / zinc
           finger (C3HC4-type RING finger) family protein similar
           to RING-H2 finger protein RHX1a [Arabidopsis thaliana]
           GI:3790591; contains Pfam profiles PF00097: Zinc finger
           C3HC4 type (RING finger), PF04588: Hypoxia induced
           protein conserved region
          Length = 349

 Score = 62.1 bits (144), Expect = 3e-10
 Identities = 28/54 (51%), Positives = 37/54 (68%)
 Frame = +3

Query: 333 RKFTENPFVPLGCLATAGALSMGLWSFRTGKTRLSQQMMRVRILAQGLTIAALV 494
           +K   NP VPLG L TAG L+ GL SFR G ++L Q +MR R++ QG T+A +V
Sbjct: 15  KKRVRNPLVPLGALMTAGVLTAGLISFRRGNSQLGQVLMRARVVVQGATVALMV 68


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,958,845
Number of Sequences: 28952
Number of extensions: 223722
Number of successful extensions: 481
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 472
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 481
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1314848736
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)