BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_M08 (364 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding pr... 24 1.5 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 3.5 >AY330172-1|AAQ16278.1| 170|Anopheles gambiae odorant-binding protein AgamOBP52 protein. Length = 170 Score = 24.2 bits (50), Expect = 1.5 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 83 KKINVETHNPSTDL*FVHYFFCVLNEISTI 172 K+ HNP T+L V Y C+ E+ + Sbjct: 51 KEREAANHNPGTELFEVCYQQCIYEELEAV 80 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.0 bits (47), Expect = 3.5 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +2 Query: 161 ISTIVHRYLPSSVTRMYRHKTQIKWYMQ 244 I ++ YLP+ + KT+++W M+ Sbjct: 333 IRSVFLHYLPAMLLMKRPRKTRLRWMME 360 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 229,290 Number of Sequences: 2352 Number of extensions: 3714 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 27084645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -