BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_M08 (364 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF098504-4|AAC67411.1| 339|Caenorhabditis elegans Hypothetical ... 27 4.0 Z73898-7|CAA98070.1| 577|Caenorhabditis elegans Hypothetical pr... 26 9.3 >AF098504-4|AAC67411.1| 339|Caenorhabditis elegans Hypothetical protein T27C10.3 protein. Length = 339 Score = 27.1 bits (57), Expect = 4.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 73 NXLKKN*CRNSQSVHRLVICALFFLCA 153 N +K N R Q++H+L+ C+ FF+ A Sbjct: 132 NFIKNNLPRFMQTLHKLIACSNFFIQA 158 >Z73898-7|CAA98070.1| 577|Caenorhabditis elegans Hypothetical protein ZK822.5a protein. Length = 577 Score = 25.8 bits (54), Expect = 9.3 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +3 Query: 132 CIIFFVCLTKFQQSCIDTYLVRLQECIVIRR 224 C +F K + +C+ Y + I+IRR Sbjct: 103 CFVFLPVFHKMKSTCLHEYFIHRYNSILIRR 133 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,855,471 Number of Sequences: 27780 Number of extensions: 77404 Number of successful extensions: 146 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 503476126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -