BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_M04 (459 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825878-1|AAV70441.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825877-1|AAV70440.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825876-1|AAV70439.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825875-1|AAV70438.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825874-1|AAV70437.1| 162|Anopheles gambiae voltage gated sodi... 23 6.8 AY825873-1|AAV70436.1| 162|Anopheles gambiae voltage gated sodi... 23 6.8 AY825872-1|AAV70435.1| 162|Anopheles gambiae voltage gated sodi... 23 6.8 AY825871-1|AAV70434.1| 162|Anopheles gambiae voltage gated sodi... 23 6.8 AY825870-1|AAV70433.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825869-1|AAV70432.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825868-1|AAV70431.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825867-1|AAV70430.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825866-1|AAV70429.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825865-1|AAV70428.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825862-1|AAV70425.1| 162|Anopheles gambiae voltage gated sodi... 23 6.8 AY825861-1|AAV70424.1| 162|Anopheles gambiae voltage gated sodi... 23 6.8 AY825860-1|AAV70423.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825859-1|AAV70422.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825858-1|AAV70421.1| 162|Anopheles gambiae voltage gated sodi... 23 6.8 AY825857-1|AAV70420.1| 162|Anopheles gambiae voltage gated sodi... 23 6.8 AY825856-1|AAV70419.1| 166|Anopheles gambiae voltage gated sodi... 23 6.8 AY825855-1|AAV70418.1| 166|Anopheles gambiae voltage gated sodi... 23 6.8 AY825854-1|AAV70417.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825853-1|AAV70416.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825852-1|AAV70415.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825851-1|AAV70414.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825850-1|AAV70413.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825849-1|AAV70412.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825848-1|AAV70411.1| 160|Anopheles gambiae voltage gated sodi... 23 6.8 AY825847-1|AAV70410.1| 160|Anopheles gambiae voltage gated sodi... 23 6.8 AY825846-1|AAV70409.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825845-1|AAV70408.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825844-1|AAV70407.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825843-1|AAV70406.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825842-1|AAV70405.1| 160|Anopheles gambiae voltage gated sodi... 23 6.8 AY825841-1|AAV70404.1| 160|Anopheles gambiae voltage gated sodi... 23 6.8 AY825840-1|AAV70403.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825839-1|AAV70402.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825838-1|AAV70401.1| 162|Anopheles gambiae voltage gated sodi... 23 6.8 AY825837-1|AAV70400.1| 162|Anopheles gambiae voltage gated sodi... 23 6.8 AY825836-1|AAV70399.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825835-1|AAV70398.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825834-1|AAV70397.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AY825833-1|AAV70396.1| 161|Anopheles gambiae voltage gated sodi... 23 6.8 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 6.8 >AY825878-1|AAV70441.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825877-1|AAV70440.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825876-1|AAV70439.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825875-1|AAV70438.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825874-1|AAV70437.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825873-1|AAV70436.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825872-1|AAV70435.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825871-1|AAV70434.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825870-1|AAV70433.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825869-1|AAV70432.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825868-1|AAV70431.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825867-1|AAV70430.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825866-1|AAV70429.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825865-1|AAV70428.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825862-1|AAV70425.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825861-1|AAV70424.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825860-1|AAV70423.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825859-1|AAV70422.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825858-1|AAV70421.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825857-1|AAV70420.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825856-1|AAV70419.1| 166|Anopheles gambiae voltage gated sodium channel protein. Length = 166 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825855-1|AAV70418.1| 166|Anopheles gambiae voltage gated sodium channel protein. Length = 166 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825854-1|AAV70417.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825853-1|AAV70416.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825852-1|AAV70415.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825851-1|AAV70414.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825850-1|AAV70413.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825849-1|AAV70412.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825848-1|AAV70411.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 55 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 85 >AY825847-1|AAV70410.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 55 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 85 >AY825846-1|AAV70409.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825845-1|AAV70408.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825844-1|AAV70407.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825843-1|AAV70406.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825842-1|AAV70405.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825841-1|AAV70404.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825840-1|AAV70403.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825839-1|AAV70402.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825838-1|AAV70401.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825837-1|AAV70400.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 57 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 87 >AY825836-1|AAV70399.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825835-1|AAV70398.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825834-1|AAV70397.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AY825833-1|AAV70396.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 56 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 86 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.6 bits (46), Expect = 6.8 Identities = 7/31 (22%), Positives = 14/31 (45%) Frame = +2 Query: 140 DKYGKLNSVWVALNPPGFAFIEFENLQEAED 232 D Y +W +P G ++ ++ L + D Sbjct: 1881 DDYDMYYEIWQQFDPDGTQYVRYDQLSDFLD 1911 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 314,692 Number of Sequences: 2352 Number of extensions: 5014 Number of successful extensions: 58 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -