BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_L22 (695 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 25 3.0 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 4.0 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 4.0 U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles ... 23 7.0 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 9.2 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 9.2 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 9.2 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 400 GDKDTVTIKAQDNADNVTFVFESPNQEKVSDYEMKLM 510 G+ + +TI A+ DN F+ Q K +DY + ++ Sbjct: 1717 GEDEQITILARHGEDNQLFLKAILGQYKQNDYNIDII 1753 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 24.2 bits (50), Expect = 4.0 Identities = 12/51 (23%), Positives = 27/51 (52%) Frame = +1 Query: 289 SLVSLTLRADGFDKYRCDRNISMGMNLGSMSKILKCAGDKDTVTIKAQDNA 441 ++ S L + F YRCDR++S + G +L + +++ + ++D + Sbjct: 119 NIPSALLFNNNFSVYRCDRSLSGSSSRGG-GVLLAVSNAYESIELPSRDRS 168 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.2 bits (50), Expect = 4.0 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 659 NFTPSFVHEITIDSPNCERSRQIXANSE 576 N + F+ I ++SP C R I NSE Sbjct: 240 NSSSFFLKAIRVESPPCLHYRAITVNSE 267 >U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles gambiae putativefatty acid binding protein mRNA, partial cds. ). Length = 141 Score = 23.4 bits (48), Expect = 7.0 Identities = 15/60 (25%), Positives = 32/60 (53%) Frame = +1 Query: 310 RADGFDKYRCDRNISMGMNLGSMSKILKCAGDKDTVTIKAQDNADNVTFVFESPNQEKVS 489 +++GFD Y +++G+ + +L+ G+ + T++ N D TF SP++ + S Sbjct: 42 KSEGFDDYM----LALGVGM-----VLRKLGNSISPTVELVKNGDEYTFNTLSPSRTRRS 92 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 9.2 Identities = 11/53 (20%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = +1 Query: 199 LEAIKDLLTQATFDCDDNGIQLQAMDNSHV--SLVS-LTLRADGFDKYRCDRN 348 + ++ + +++G ++ A+ + + S+ S + L +D ++ YRCDR+ Sbjct: 14 VRGLRTKYNELRLSANESGFEMLALTETWLNESIPSNMVLDSDSYNIYRCDRS 66 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 253 GIQLQAMDNSHVSLVSLTLRADGFDKY 333 G+Q+ A+ H +V +L DGF Y Sbjct: 913 GVQMDALQMFHNIIVFRSLFLDGFKMY 939 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 253 GIQLQAMDNSHVSLVSLTLRADGFDKY 333 G+Q+ A+ H +V +L DGF Y Sbjct: 914 GVQMDALQMFHNIIVFRSLFLDGFKMY 940 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,817 Number of Sequences: 2352 Number of extensions: 13544 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -