BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_L21 (568 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4.05 |mlo2||zinc finger protein Mlo2|Schizosaccharomyces pom... 27 2.5 SPCC830.09c |||RNase P and RNase MRP subunit |Schizosaccharomyce... 26 3.4 SPBC359.01 ||SPBPB10D8.08|amino acid permease, unknown 7|Schizos... 26 4.4 SPAC343.10 |met11|mthfr2|methylenetetrahydrofolate reductase Met... 26 4.4 SPAC5D6.07c |||PXA domain protein|Schizosaccharomyces pombe|chr ... 25 7.7 >SPBC4.05 |mlo2||zinc finger protein Mlo2|Schizosaccharomyces pombe|chr 2|||Manual Length = 329 Score = 26.6 bits (56), Expect = 2.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 404 QPPGHGEDGDCNMPHEPXQPRQVFGHVLNSSGQDV 508 +PP EDG M +P + ++ V++S+ DV Sbjct: 235 EPPEDSEDGISEMNEDPSESGEMIEQVISSTMNDV 269 >SPCC830.09c |||RNase P and RNase MRP subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 139 Score = 26.2 bits (55), Expect = 3.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 92 VLYQEKKRLYDFFETPAHNNVTTS 21 VLY E K +D+ P+ +++TTS Sbjct: 13 VLYPEAKEFFDYPTIPSDSSITTS 36 >SPBC359.01 ||SPBPB10D8.08|amino acid permease, unknown 7|Schizosaccharomyces pombe|chr 2|||Manual Length = 581 Score = 25.8 bits (54), Expect = 4.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 504 SCPLELSTCPKTCRGW 457 +CPLEL+TC T + W Sbjct: 169 TCPLELTTCAITFKFW 184 >SPAC343.10 |met11|mthfr2|methylenetetrahydrofolate reductase Met11|Schizosaccharomyces pombe|chr 1|||Manual Length = 641 Score = 25.8 bits (54), Expect = 4.4 Identities = 9/38 (23%), Positives = 20/38 (52%) Frame = -1 Query: 526 FSLSDSDILST*VKHVSKDLSGLVWFMRHITISIFSVS 413 + + +SDI S KH+ D+S + W + + +++ Sbjct: 434 YPVDESDITSLFQKHIMSDISAIPWIDEPVEVETKTIA 471 >SPAC5D6.07c |||PXA domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 495 Score = 25.0 bits (52), Expect = 7.7 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 219 KKFITTQLAPVWRDFRGLVKVKMVPY 296 K+ ITT + VW FR L+ + VPY Sbjct: 183 KESITTAVRWVWHAFRILLITRGVPY 208 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,374,383 Number of Sequences: 5004 Number of extensions: 47612 Number of successful extensions: 120 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -