BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_L21 (568 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 25 2.3 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 25 2.3 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 25 2.3 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 25 2.3 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 3.0 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 24 4.0 AY341156-1|AAR13720.1| 98|Anopheles gambiae BolA protein. 23 9.2 AY341155-1|AAR13719.1| 98|Anopheles gambiae BolA protein. 23 9.2 AY341154-1|AAR13718.1| 98|Anopheles gambiae BolA protein. 23 9.2 AY341153-1|AAR13717.1| 98|Anopheles gambiae BolA protein. 23 9.2 AY341152-1|AAR13716.1| 98|Anopheles gambiae BolA protein. 23 9.2 AY341151-1|AAR13715.1| 98|Anopheles gambiae BolA protein. 23 9.2 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 299 PIRDHFDFDKSSEVPPDGSQL 237 P ++FD SSE PP +QL Sbjct: 147 PHHEYFDSKSSSETPPSYNQL 167 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 299 PIRDHFDFDKSSEVPPDGSQL 237 P ++FD SSE PP +QL Sbjct: 147 PHHEYFDSKSSSETPPSYNQL 167 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 299 PIRDHFDFDKSSEVPPDGSQL 237 P ++FD SSE PP +QL Sbjct: 147 PHHEYFDSKSSSETPPSYNQL 167 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 299 PIRDHFDFDKSSEVPPDGSQL 237 P ++FD SSE PP +QL Sbjct: 147 PHHEYFDSKSSSETPPSYNQL 167 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.2 bits (50), Expect = 3.0 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = -2 Query: 390 RKLAPCCRSTRQRR---GGR*MTISHPPCRACSSHTGP 286 RK+ P R+ R+R GGR + PP R S T P Sbjct: 248 RKIPPSRRNPRRRSPRSGGRWPSCRSPPARRRSRSTRP 285 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.8 bits (49), Expect = 4.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 436 TISIFSVSWRLRSF 395 T+S+FSV W L SF Sbjct: 319 TLSLFSVCWALASF 332 >AY341156-1|AAR13720.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 22.6 bits (46), Expect = 9.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 228 ITTQLAPVWRDFRGLVKVKMVPYGKSTHDKV 320 +T +LAPV + + VP G TH KV Sbjct: 5 LTKELAPVHLEVVNESYMHNVPKGSETHFKV 35 >AY341155-1|AAR13719.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 22.6 bits (46), Expect = 9.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 228 ITTQLAPVWRDFRGLVKVKMVPYGKSTHDKV 320 +T +LAPV + + VP G TH KV Sbjct: 5 LTKELAPVHLEVVNESYMHNVPKGSETHFKV 35 >AY341154-1|AAR13718.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 22.6 bits (46), Expect = 9.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 228 ITTQLAPVWRDFRGLVKVKMVPYGKSTHDKV 320 +T +LAPV + + VP G TH KV Sbjct: 5 LTKELAPVHLEVVNESYMHNVPKGSETHFKV 35 >AY341153-1|AAR13717.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 22.6 bits (46), Expect = 9.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 228 ITTQLAPVWRDFRGLVKVKMVPYGKSTHDKV 320 +T +LAPV + + VP G TH KV Sbjct: 5 LTKELAPVHLEVVNESYMHNVPKGSETHFKV 35 >AY341152-1|AAR13716.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 22.6 bits (46), Expect = 9.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 228 ITTQLAPVWRDFRGLVKVKMVPYGKSTHDKV 320 +T +LAPV + + VP G TH KV Sbjct: 5 LTKELAPVHLEVVNESYMHNVPKGSETHFKV 35 >AY341151-1|AAR13715.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 22.6 bits (46), Expect = 9.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 228 ITTQLAPVWRDFRGLVKVKMVPYGKSTHDKV 320 +T +LAPV + + VP G TH KV Sbjct: 5 LTKELAPVHLEVVNESYMHNVPKGSETHFKV 35 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 608,631 Number of Sequences: 2352 Number of extensions: 13215 Number of successful extensions: 27 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -