BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_L14 (536 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 58 4e-11 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 3.5 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 4.6 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 6.0 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 8.0 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 8.0 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 8.0 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 58.4 bits (135), Expect = 4e-11 Identities = 36/87 (41%), Positives = 46/87 (52%), Gaps = 1/87 (1%) Frame = +2 Query: 149 KDAVILQQTFDNIGLEG-YGFGFETSDGKTAQESAVLKNVGTENEALEVRGQYSYVDLDG 325 KDAVI Q + + +G Y FETS+G + QES K V E + +G SY DG Sbjct: 25 KDAVITSQQLE-VNFDGNYINNFETSNGISHQESGQPKQVDNETPVVS-QGSDSYTAPDG 82 Query: 326 KVHETTYTADENGFHPSGADIPQLPQV 406 + TY ADENGF G+ IP P + Sbjct: 83 QQVSITYVADENGFQVQGSHIPTAPPI 109 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/36 (25%), Positives = 14/36 (38%) Frame = -3 Query: 378 PEGWKPFSSAVYVVSWTFPSRSTYEYCPRTSRASFS 271 PE WKP + + P P++ +S S Sbjct: 418 PEDWKPLDKCYFCLDGKLPHDDQPPLSPQSDSSSSS 453 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 319 EVDVRVLSANLKSLIFGT 266 +V+ R+L AN+K LI T Sbjct: 395 DVNFRILGANVKELIRNT 412 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 6.0 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = -1 Query: 392 GECLLRRDGNHFRQRCTSSRGPFHRGRRTSTVREPQEPHFR 270 G C RR N +S HR + T + PQ P FR Sbjct: 534 GLCPHRRRANS--GSTSSGDDELHRASLSKTPQPPQCPRFR 572 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 8.0 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -1 Query: 437 DYIFRWCWW 411 D I RWC W Sbjct: 383 DKIIRWCTW 391 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 8.0 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -1 Query: 437 DYIFRWCWW 411 D I RWC W Sbjct: 383 DKIIRWCTW 391 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 8.0 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -1 Query: 437 DYIFRWCWW 411 D I RWC W Sbjct: 383 DKIIRWCTW 391 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,803 Number of Sequences: 438 Number of extensions: 2842 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -