BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_L13 (825 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 26 0.49 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 26 0.49 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 25 1.1 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 25 1.1 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 23 2.6 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 23 3.4 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 25.8 bits (54), Expect = 0.49 Identities = 22/98 (22%), Positives = 41/98 (41%) Frame = +1 Query: 346 QELRHREEP*SRLHKDKGTVCRNREIRSRD*NVLWSDVKSNRRRNEGDVTEAIREGRNIE 525 +E R ++ +LH +K + R R R +S + + + + E + + Sbjct: 232 REYRKKDRQYEKLHNEKEKLLEERTSRKR-----YSRSREREQNSYKNEREYRKYRETSK 286 Query: 526 GRLDGNETERSLQREFAICSENGCELASDNENISAIEL 639 GR + TER +E I S N + N N ++ +L Sbjct: 287 GR-SRDRTERERSKETKIISSNNYNYKNYNNNYNSKKL 323 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.8 bits (54), Expect = 0.49 Identities = 22/98 (22%), Positives = 41/98 (41%) Frame = +1 Query: 346 QELRHREEP*SRLHKDKGTVCRNREIRSRD*NVLWSDVKSNRRRNEGDVTEAIREGRNIE 525 +E R ++ +LH +K + R R R +S + + + + E + + Sbjct: 243 REYRKKDRQYEKLHNEKEKLLEERTSRKR-----YSRSREREQNSYKNEREYRKYRETSK 297 Query: 526 GRLDGNETERSLQREFAICSENGCELASDNENISAIEL 639 GR + TER +E I S N + N N ++ +L Sbjct: 298 GR-SRDRTERERSKETKIISSNNYNYKNYNNNYNSKKL 334 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 24.6 bits (51), Expect = 1.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 748 IRPRVRCASYRRVPFIVETAVRHLSLQYVAPYVVIRPV 635 ++ +RC YR IVET + Y P+ PV Sbjct: 266 VKEMIRCLRYRPARAIVETLANFMRF-YYNPFTPFGPV 302 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 24.6 bits (51), Expect = 1.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 748 IRPRVRCASYRRVPFIVETAVRHLSLQYVAPYVVIRPV 635 ++ +RC YR IVET + Y P+ PV Sbjct: 266 VKEMIRCLRYRPARAIVETLANFMRF-YYNPFTPFGPV 302 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 23.4 bits (48), Expect = 2.6 Identities = 17/63 (26%), Positives = 33/63 (52%) Frame = +2 Query: 383 YIRTKGPFVEIEKFVQEIKMYYGLTLKVTEGEMKETLQRLLEKDGILKAGLMGTRRSDPY 562 Y+ TK PF++ E ++ Y G V + E++ +++ K+G+L GLM + Sbjct: 278 YVNTK-PFMKSEYGANNVQ-YQG----VQDIFNTESIAKIMSKNGVLFFGLMNNSAIGCW 331 Query: 563 SEN 571 +E+ Sbjct: 332 NEH 334 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 23.0 bits (47), Expect = 3.4 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -3 Query: 748 IRPRVRCASYRRVPFIVETAVRHLSLQY 665 ++ +RC YR IVET + Y Sbjct: 137 VKEMIRCLRYRPARAIVETLANFMRFYY 164 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,024 Number of Sequences: 438 Number of extensions: 4672 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26338809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -