BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_L06 (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 66 7e-13 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 27 0.54 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 25 2.2 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 24 5.0 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 23 6.7 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 6.7 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 66.5 bits (155), Expect = 7e-13 Identities = 35/98 (35%), Positives = 55/98 (56%), Gaps = 2/98 (2%) Frame = +1 Query: 388 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLXGVXQT 567 +V VSG + ++ FE + + V V+ Y +PTPIQ PI ++G++L QT Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQT 220 Query: 568 GSGKTLAYILPAIVH-INNQPPIR-RGDGPIAXVLAPT 675 GSGKT A++LP I H ++ + + R P ++APT Sbjct: 221 GSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPT 258 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 27.1 bits (57), Expect = 0.54 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 523 PIAMSGKNLXGVXQTGSGKTLAYILPAIVHINNQPPIRRGDG 648 P+A + K L Q + ++ I A+V + Q +RR DG Sbjct: 451 PVASNYKTLNYKAQKAAARSHVKIFKALVRLRKQRTLRRNDG 492 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 25.0 bits (52), Expect = 2.2 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 6/38 (15%) Frame = -1 Query: 262 ALQRILFSHQSLQILQ------IYCHRCQTETNYRRIC 167 A +R+ SHQS IL+ I CHRC+ + +R C Sbjct: 180 AQKRMEKSHQSESILRVGPEKKITCHRCRKPGHMKRDC 217 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.8 bits (49), Expect = 5.0 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -2 Query: 189 RRIIAEFVASSKFGTTVSTAIIPITRHDYFSDLVEDVXLNY 67 RR+ A+ A ++F I+ YF D+V DV L Y Sbjct: 59 RRVRAKSKAMTEFLPLCDVLFNVISLAGYFCDVVFDVVLGY 99 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 23.4 bits (48), Expect = 6.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 151 WNHRFHGYYSNY 116 W R HGYY+NY Sbjct: 197 WIIRPHGYYANY 208 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 340 VLKRSPYEVEEYRNKHEVTVSGVEVHNPIQY 432 V++R P V+ + H+V V VH P+ + Sbjct: 139 VVRREPSAVKIAQPVHKVIAQPVHVHAPVAH 169 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 672,095 Number of Sequences: 2352 Number of extensions: 13691 Number of successful extensions: 31 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -