BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_L02 (736 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 26 0.27 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 26 0.27 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 26 0.27 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 24 1.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.4 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 3.4 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 7.8 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 26.2 bits (55), Expect = 0.27 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = -2 Query: 732 WNIPMSLLNNFITKSIIILWGLNFVVNIFAALTLRGLLYNIFKIPKTTLWMHNQK 568 +NI M+L+ FIT +W N ++F L L Y ++ T M K Sbjct: 208 YNIVMALVLQFITLQHTFIWVFN---DVFVMLLSTALAYRFTQVTDRTQSMSESK 259 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 26.2 bits (55), Expect = 0.27 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = -2 Query: 732 WNIPMSLLNNFITKSIIILWGLNFVVNIFAALTLRGLLYNIFKIPKTTLWMHNQK 568 +NI M+L+ FIT +W N ++F L L Y ++ T M K Sbjct: 208 YNIVMALVLQFITLQHTFIWVFN---DVFVMLLSTALAYRFTQVTDRTQSMSESK 259 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 26.2 bits (55), Expect = 0.27 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = -2 Query: 732 WNIPMSLLNNFITKSIIILWGLNFVVNIFAALTLRGLLYNIFKIPKTTLWMHNQK 568 +NI M+L+ FIT +W N ++F L L Y ++ T M K Sbjct: 208 YNIVMALVLQFITLQHTFIWVFN---DVFVMLLSTALAYRFTQVTDRTQSMSESK 259 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 23.8 bits (49), Expect = 1.5 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -3 Query: 617 IIYLRYQKLLYGCIIKNKFLSNHHTFEHTKIIDLL*LEALKKYIV 483 II L +LY CII +SN T K ID + L A K+ ++ Sbjct: 247 IIPLIILLILY-CIIAKNLMSNAATLVLNKHIDNISLRARKQVVL 290 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 198 LNYLLNKGADPNVV 239 LNY + KGADP + Sbjct: 2546 LNYWIEKGADPGKI 2559 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 516 IIIRSFKKIYC*IFV*IYTLA*QSKFISEMIKV 418 I+IRSFK Y + + T QSK + E++ + Sbjct: 191 ILIRSFKSRYKDLNQKLETACEQSKSVEELMNI 223 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 Query: 225 DPNVVDKHGISVLLAAIWEGHTDC 296 DP+ V HG V+ + + + DC Sbjct: 444 DPSSVLSHGHRVIYSTVGHWYLDC 467 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,167 Number of Sequences: 336 Number of extensions: 3594 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -