BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_L01 (376 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80953-1|AAB52557.2| 56|Caenorhabditis elegans Ribosomal prote... 79 1e-15 Z72504-3|CAA96605.1| 449|Caenorhabditis elegans Hypothetical pr... 31 0.27 AF273784-1|AAG15133.1| 459|Caenorhabditis elegans nuclear recep... 31 0.27 Z74040-6|CAA98509.2| 457|Caenorhabditis elegans Hypothetical pr... 29 0.82 Z70311-6|CAA94379.3| 442|Caenorhabditis elegans Hypothetical pr... 28 1.9 AF022985-15|AAB69969.2| 435|Caenorhabditis elegans Hypothetical... 28 1.9 U53341-1|AAC69110.3| 727|Caenorhabditis elegans Hypothetical pr... 27 4.4 Z66567-1|CAA91491.1| 887|Caenorhabditis elegans Hypothetical pr... 27 5.8 >U80953-1|AAB52557.2| 56|Caenorhabditis elegans Ribosomal protein, small subunitprotein 29 protein. Length = 56 Score = 79.0 bits (186), Expect = 1e-15 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +2 Query: 128 YGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 256 +G GSRSCR C+ HGLIRKYGL++CR+CFRE A DIGFKKLD Sbjct: 14 FGPGSRSCRVCAGHHGLIRKYGLDLCRRCFREQARDIGFKKLD 56 Score = 27.1 bits (57), Expect = 4.4 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 88 MGHANLWYSHPR 123 MG NLW+SHPR Sbjct: 1 MGFQNLWFSHPR 12 >Z72504-3|CAA96605.1| 449|Caenorhabditis elegans Hypothetical protein C29E6.5 protein. Length = 449 Score = 31.1 bits (67), Expect = 0.27 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 149 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 250 CR C R+ + +G++ICR C + + KK Sbjct: 47 CRVCERRYDGSQHFGIDICRACAAFFRRSVAVKK 80 >AF273784-1|AAG15133.1| 459|Caenorhabditis elegans nuclear receptor NHR-43 protein. Length = 459 Score = 31.1 bits (67), Expect = 0.27 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 149 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 250 CR C R+ + +G++ICR C + + KK Sbjct: 57 CRVCERRYDGSQHFGIDICRACAAFFRRSVAVKK 90 >Z74040-6|CAA98509.2| 457|Caenorhabditis elegans Hypothetical protein K10D6.1 protein. Length = 457 Score = 29.5 bits (63), Expect = 0.82 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 148 MPILLQQAWLNPQVRFEHMQTVLQRVCS*HRIQE 249 M I + + WL+P ++F+H+ Q + H++ E Sbjct: 101 MDIYINEMWLDPALKFDHLNPCKQNLSVSHQVLE 134 >Z70311-6|CAA94379.3| 442|Caenorhabditis elegans Hypothetical protein T25B9.8 protein. Length = 442 Score = 28.3 bits (60), Expect = 1.9 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -2 Query: 189 YLRIKPCLLEQDRHDRDPCPXTARVRIPKICVAHFKKL 76 Y+ I C++ D++D D AR++ K CV+H +L Sbjct: 311 YIMIYVCVMN-DKYDMDKAKELARMQRFKCCVSHLDEL 347 >AF022985-15|AAB69969.2| 435|Caenorhabditis elegans Hypothetical protein T15B7.16 protein. Length = 435 Score = 28.3 bits (60), Expect = 1.9 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 148 MPILLQQAWLNPQVRFEHMQTVLQRV 225 + +L Q W +P++RF+H+ LQ + Sbjct: 80 LDLLFSQIWHDPRLRFDHLTNCLQNL 105 >U53341-1|AAC69110.3| 727|Caenorhabditis elegans Hypothetical protein F49E10.5 protein. Length = 727 Score = 27.1 bits (57), Expect = 4.4 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 136 RISVMPILLQQAWLNPQVRFEHMQTVLQRVCS*H 237 RI P++L+Q WL R E R+CS H Sbjct: 27 RIPKRPLILRQRWLTAIGRTEETVVSQLRICSAH 60 >Z66567-1|CAA91491.1| 887|Caenorhabditis elegans Hypothetical protein ZK455.1 protein. Length = 887 Score = 26.6 bits (56), Expect = 5.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 68 QQFNFLKWATQIFGILTLAVYGQG 139 ++FNFLKW ++ F L + G G Sbjct: 150 ERFNFLKWGSKAFDNLLIVPPGSG 173 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,566,983 Number of Sequences: 27780 Number of extensions: 119371 Number of successful extensions: 288 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 288 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 546325158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -