BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_K19 (601 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 26 1.1 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 25 2.5 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 4.3 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 5.7 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 10.0 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 10.0 AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismuta... 23 10.0 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 25.8 bits (54), Expect = 1.1 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 356 IHNALLDALAVGEEEDADHHLHNDDHQQKDCVRDDH 249 IH+ALL+A+ G E LHN H QK + H Sbjct: 924 IHDALLEAVICGSTEVPARSLHN--HIQKLMQTEPH 957 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 24.6 bits (51), Expect = 2.5 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = -3 Query: 368 HADAIHNALLDAL--AVGEEEDADHHLHNDDHQQKDCVRDDHAVTLAYRSTASQERDHEH 195 +AD ++N L ++ E D+D HL + DH D + D + LA S R H Sbjct: 443 NADDMNNILAPGNMGSLNESGDSDAHLSHPDH--PDNIDGDRMLRLAMASRHHHHRAGLH 500 Query: 194 Y 192 + Sbjct: 501 H 501 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.8 bits (49), Expect = 4.3 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 266 NLFAGDHHCASGDQRPP 316 +LFA HH ++GD +PP Sbjct: 472 SLFASHHH-STGDNKPP 487 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -3 Query: 341 LDALAVGEEEDADHHLHNDDHQQKDCVRDDHAV 243 L+ ++ED D +DD + +DC + H + Sbjct: 1190 LNGAGNNDDEDEDDD-EDDDDEDEDCADEQHPI 1221 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/38 (26%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +3 Query: 333 SIKESIMDGV-GVLFKKRSDANADEAAEAVFSELQRQF 443 ++ +I G+ + FKK+ + A E + S++ +QF Sbjct: 3165 TVVRNIASGLRNLFFKKKPEQQAHEVSTLEHSQIDKQF 3202 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/38 (26%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +3 Query: 333 SIKESIMDGV-GVLFKKRSDANADEAAEAVFSELQRQF 443 ++ +I G+ + FKK+ + A E + S++ +QF Sbjct: 3168 TVVRNIASGLRNLFFKKKPEQQAHEVSTLEHSQIDKQF 3205 >AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismutase 1 protein. Length = 206 Score = 22.6 bits (46), Expect = 10.0 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -3 Query: 410 GGLVCVSVRSLFE*HADAIHNALLDALAVGEEEDAD 303 G L V R + E H HNA + L EE+ D Sbjct: 44 GALEPVICREIMELHHQKHHNAYVTNLNAAEEQLQD 79 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 546,401 Number of Sequences: 2352 Number of extensions: 10659 Number of successful extensions: 25 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -