BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_K13 (766 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_11291| Best HMM Match : LSM (HMM E-Value=6.5e-11) 36 0.027 >SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1311 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/64 (28%), Positives = 33/64 (51%) Frame = +3 Query: 123 VRFLMKLSHEXVTIELKNGSVVHGTITGVDVAMNTHLKAVKVTLKNREELQLETLSIRGN 302 ++ L + +T+E NG V G + + MN + + VT ++ QLE + +RG+ Sbjct: 7 IKILHEAEGHVITLETLNGEVYRGKLIEAEDNMNCQMSNITVTARDGRVSQLEQVFVRGS 66 Query: 303 NIRY 314 IR+ Sbjct: 67 KIRF 70 >SB_11291| Best HMM Match : LSM (HMM E-Value=6.5e-11) Length = 114 Score = 36.3 bits (80), Expect = 0.027 Identities = 22/65 (33%), Positives = 31/65 (47%) Frame = +3 Query: 120 LVRFLMKLSHEXVTIELKNGSVVHGTITGVDVAMNTHLKAVKVTLKNREELQLETLSIRG 299 LV + + T+EL+N S + G I VD MN +K VK + E L + + G Sbjct: 13 LVCLIKAVQGYNTTVELRNESYLEGFIEHVDGFMNIKMKDVKFVKASGEVDNLPAMFVVG 72 Query: 300 NNIRY 314 IRY Sbjct: 73 TQIRY 77 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,607,204 Number of Sequences: 59808 Number of extensions: 318080 Number of successful extensions: 604 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -