BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_K11 (468 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.3 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 4.3 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 4.3 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 5.7 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 5.7 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 7.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 20 9.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 3.3 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -3 Query: 352 DDFHACWLTIPSSLWNSFLEVP 287 + H W T PS+ W+S P Sbjct: 1029 EHMHPDWTTKPSTWWSSTTTSP 1050 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.4 bits (43), Expect = 4.3 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 340 ACWLTIPSSLWNSFLEV 290 +CW + LW S L V Sbjct: 392 SCWAQFKAVLWRSILAV 408 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.4 bits (43), Expect = 4.3 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 Query: 340 ACWLTIPSSLWNSFLEV 290 +CW + LW S L V Sbjct: 392 SCWAQFKAVLWRSILAV 408 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 5.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 327 LFLLHFGTAFWRYL*LSPFHVQVVR 253 +F HF AF Y S F++ VVR Sbjct: 307 IFPTHFYCAFSLYPLKSTFYLNVVR 331 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.0 bits (42), Expect = 5.7 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -2 Query: 254 VGPRCDSDV 228 VGPRC+ D+ Sbjct: 291 VGPRCEGDI 299 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 20.6 bits (41), Expect = 7.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 17 LWIFHFTLWLWKSGKFQFIFENK 85 LWI FTL + SG ++ F K Sbjct: 36 LWILLFTLGVTISGVYRTDFYKK 58 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 20.2 bits (40), Expect = 9.9 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +3 Query: 252 NGRPAHEKD*VRGTSRKLFQSEEGIVNQHA*KSSTINLCRIV 377 NG+P ++ + T KLF+ ++ + A +T + R V Sbjct: 880 NGKPTCWRECDKATCEKLFRMKKSSALRPASGGTTARVVRCV 921 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,249 Number of Sequences: 336 Number of extensions: 1855 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10826639 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -