BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_K09 (729 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77940.1 68414.m09083 60S ribosomal protein L30 (RPL30B) simi... 97 8e-21 At3g18740.1 68416.m02379 60S ribosomal protein L30 (RPL30C) simi... 97 1e-20 At1g36240.1 68414.m04505 60S ribosomal protein L30 (RPL30A) simi... 95 4e-20 At1g80410.1 68414.m09413 acetyltransferase-related low similarit... 29 4.2 At3g02300.1 68416.m00212 regulator of chromosome condensation (R... 28 5.5 At3g26618.1 68416.m03325 eukaryotic release factor 1 family prot... 28 7.3 At1g12920.1 68414.m01500 eukaryotic release factor 1 family prot... 27 9.6 >At1g77940.1 68414.m09083 60S ribosomal protein L30 (RPL30B) similar to ribosomal protein L30 GI:388034 from [Homo sapiens] Length = 112 Score = 97.5 bits (232), Expect = 8e-21 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = +1 Query: 559 RKSEIEYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 720 R+SEIEYYA+LAK GVHHY+GNN++LGTACGKY+RV L+I DPGDSDII ++P Sbjct: 56 RRSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIVDPGDSDIIKSIP 109 Score = 77.0 bits (181), Expect = 1e-14 Identities = 37/56 (66%), Positives = 42/56 (75%) Frame = +2 Query: 68 MVAAKKQXKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLR 235 MV KK K+ E INSRLALVMKSGKY LGYK LK+LR K KL++I+ N PPLR Sbjct: 1 MVTEKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRGSKGKLILISTNCPPLR 56 >At3g18740.1 68416.m02379 60S ribosomal protein L30 (RPL30C) similar to 60S RIBOSOMAL PROTEIN L30 GB:O49884 from [Lupinus luteus] Length = 112 Score = 96.7 bits (230), Expect = 1e-20 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = +1 Query: 559 RKSEIEYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 720 R+SEIEYYA+LAK GVH Y+GNN++LGTACGKY+RV L+I DPGDSDII TLP Sbjct: 56 RRSEIEYYAMLAKVGVHRYNGNNVDLGTACGKYFRVSCLSIVDPGDSDIIKTLP 109 Score = 79.8 bits (188), Expect = 2e-15 Identities = 38/56 (67%), Positives = 43/56 (76%) Frame = +2 Query: 68 MVAAKKQXKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLR 235 MVA KK K+ E INSRLALVMKSGKY LGYK LK+LR K KL++I+ N PPLR Sbjct: 1 MVAEKKAKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLR 56 >At1g36240.1 68414.m04505 60S ribosomal protein L30 (RPL30A) similar to GI:6984132 from [Euphorbia esula] Length = 112 Score = 95.1 bits (226), Expect = 4e-20 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = +1 Query: 559 RKSEIEYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 720 R+SEIEYYA+LAK GVHHY+ NN++LGTACGKY+RV L+I DPGDSDII +LP Sbjct: 56 RRSEIEYYAMLAKVGVHHYNRNNVDLGTACGKYFRVSCLSIVDPGDSDIIKSLP 109 Score = 81.8 bits (193), Expect = 4e-16 Identities = 39/56 (69%), Positives = 44/56 (78%) Frame = +2 Query: 68 MVAAKKQXKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPLR 235 MVAAKK K+ E INSRLALVMKSGKY LGYK LK+LR K KL++I+ N PPLR Sbjct: 1 MVAAKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLR 56 >At1g80410.1 68414.m09413 acetyltransferase-related low similarity to acetyltransferase Tubedown-1 [Mus musculus] GI:8497318, N-TERMINAL ACETYLTRANSFERASE GB:P12945 from (Saccharomyces cerevisiae); contains Pfam profile PF00515 TPR Domain Length = 897 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 467 IKLHSFLNTVLLDHNVGNLWSSL*TRYF 550 I +H+ L+TVLLD + W S YF Sbjct: 814 IAVHTLLDTVLLDSQAASRWKSRCAEYF 841 >At3g02300.1 68416.m00212 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 471 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 98 IESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPP 229 I + +++ KS Y GY Q+ +T R + KL+ I K PP Sbjct: 7 IGEVAPSVSIPTKSAIYVWGYNQSGQTGRNEQEKLLRIPKQLPP 50 >At3g26618.1 68416.m03325 eukaryotic release factor 1 family protein / eRF1 family protein contains Pfam profiles: PF03463 eRF1 domain 1, PF03464 eRF1 domain 2, PF03465 eRF1 domain 3 Length = 435 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 137 SGKYCLGYKQTLKTLRQGKAKLVIIAKN 220 +GKY G + TLK L G + +I+ +N Sbjct: 298 TGKYVFGVEDTLKALEMGAVETLIVWEN 325 >At1g12920.1 68414.m01500 eukaryotic release factor 1 family protein / eRF1 family protein contains Pfam profiles: PF03463 eRF1 domain 1, PF03464 eRF1 domain 2, PF03465 eRF1 domain 3 Length = 434 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 137 SGKYCLGYKQTLKTLRQGKAKLVIIAKN 220 +GKY G + TLK L G + +I+ +N Sbjct: 297 TGKYVFGVEDTLKALEMGAIETLIVWEN 324 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,336,437 Number of Sequences: 28952 Number of extensions: 296588 Number of successful extensions: 541 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -