BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_K06 (500 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 21 8.2 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 8.2 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 20.6 bits (41), Expect = 8.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 169 VFKRNTPSLSVI*YAKLSDTLNMRRGLWSYLRC 267 +F P L+ I + TLN RR L L+C Sbjct: 19 IFTCVKPQLTRISDEAIESTLNDRRYLLRQLKC 51 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 20.6 bits (41), Expect = 8.2 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 416 IYHLMVMVMSLGGCLPHLSE 357 +YH+ M S GC ++E Sbjct: 342 LYHISFMACSSAGCSQKVAE 361 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,297 Number of Sequences: 336 Number of extensions: 1330 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11839801 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -