BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_K02 (657 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0238 - 1976645-1977561,1977649-1977909,1978243-1978275,198... 31 1.1 01_06_1584 - 38441654-38442847 28 5.7 >01_01_0238 - 1976645-1977561,1977649-1977909,1978243-1978275, 1980556-1981345 Length = 666 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 7/57 (12%) Frame = -2 Query: 374 RNSLFFISLDGIIYESNSILLKSEYSYLQYH*CPI-DFSVISGL------LSSSNKY 225 R+ LF + D I YE+NS++ E ++ CP+ DF+V S L +S++NKY Sbjct: 80 RDHLFRV--DSIFYENNSLVAAVETTFAGDADCPVPDFNVTSSLSPYPFIISNTNKY 134 >01_06_1584 - 38441654-38442847 Length = 397 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -2 Query: 452 ITSVAVIIIRIWLFIGKIIRLS 387 +T + +I+I IW +G+I+RLS Sbjct: 56 VTRIVLILITIWWGVGEIVRLS 77 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,573,448 Number of Sequences: 37544 Number of extensions: 136317 Number of successful extensions: 214 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 214 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -