BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_J23 (587 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosacchar... 27 1.5 >SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosaccharomyces pombe|chr 3|||Manual Length = 902 Score = 27.5 bits (58), Expect = 1.5 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Frame = -3 Query: 402 GNNLILTL*VGS-YR*YMCHKLK--FVAP*LDKTILCKQLFK 286 G + ++T VG+ ++ Y C KL FV LDK I C + FK Sbjct: 45 GTHFLVTTSVGNTFQTYDCEKLNLLFVGKQLDKEITCLKSFK 86 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,775,254 Number of Sequences: 5004 Number of extensions: 27832 Number of successful extensions: 61 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 254167452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -