BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_J23 (587 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X51405-1|CAA35767.1| 476|Homo sapiens protein ( Human mRNA for ... 29 9.2 BC053612-1|AAH53612.1| 476|Homo sapiens carboxypeptidase E prot... 29 9.2 BC033866-1|AAH33866.1| 476|Homo sapiens carboxypeptidase E prot... 29 9.2 AB006898-1|BAA86053.1| 476|Homo sapiens carboxypeptidase E prot... 29 9.2 >X51405-1|CAA35767.1| 476|Homo sapiens protein ( Human mRNA for carboxypeptidase E (EC 3.4.17.10). ). Length = 476 Score = 29.5 bits (63), Expect = 9.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 6 GR*YTVPTALQDEHFLLYHCFDLCVPRICLRSP 104 G Y+VP +QD ++L +CF++ V C + P Sbjct: 317 GAWYSVPGGMQDFNYLSSNCFEITVELSCEKFP 349 >BC053612-1|AAH53612.1| 476|Homo sapiens carboxypeptidase E protein. Length = 476 Score = 29.5 bits (63), Expect = 9.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 6 GR*YTVPTALQDEHFLLYHCFDLCVPRICLRSP 104 G Y+VP +QD ++L +CF++ V C + P Sbjct: 317 GAWYSVPGGMQDFNYLSSNCFEITVELSCEKFP 349 >BC033866-1|AAH33866.1| 476|Homo sapiens carboxypeptidase E protein. Length = 476 Score = 29.5 bits (63), Expect = 9.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 6 GR*YTVPTALQDEHFLLYHCFDLCVPRICLRSP 104 G Y+VP +QD ++L +CF++ V C + P Sbjct: 317 GAWYSVPGGMQDFNYLSSNCFEITVELSCEKFP 349 >AB006898-1|BAA86053.1| 476|Homo sapiens carboxypeptidase E protein. Length = 476 Score = 29.5 bits (63), Expect = 9.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 6 GR*YTVPTALQDEHFLLYHCFDLCVPRICLRSP 104 G Y+VP +QD ++L +CF++ V C + P Sbjct: 317 GAWYSVPGGMQDFNYLSSNCFEITVELSCEKFP 349 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,011,704 Number of Sequences: 237096 Number of extensions: 931567 Number of successful extensions: 1360 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1360 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6155099854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -