BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_J16 (651 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75714-1|CAB00058.1| 194|Caenorhabditis elegans Hypothetical pr... 221 3e-58 U70849-11|AAK29800.1| 897|Caenorhabditis elegans Hypothetical p... 28 6.6 U70849-10|AAK29799.1| 910|Caenorhabditis elegans Hypothetical p... 28 6.6 >Z75714-1|CAB00058.1| 194|Caenorhabditis elegans Hypothetical protein ZC434.2 protein. Length = 194 Score = 221 bits (540), Expect = 3e-58 Identities = 102/169 (60%), Positives = 135/169 (79%), Gaps = 1/169 (0%) Frame = +3 Query: 102 SQALVELETNSDLKAQLRXLYITKAKXIELHNKXSIIIYVPMPKLKAFQKXQIRLVRELE 281 SQAL++LETN D+++QL+ LYI K +EL NK +IIIYVP+P+LKAF K LVRELE Sbjct: 24 SQALIDLETNDDVQSQLKELYIVGVKEVELGNKSAIIIYVPVPQLKAFHKIHPALVRELE 83 Query: 282 KKFSGKHVVFVGDRKILPKPSHKTRVA-NKQKRPRSRTLTSVYDAILEDLVFPAEIVGKR 458 KKF G+ ++ + R+ILPKP ++ KQKRPRSRTLT+V+DA L++LV+PAE+VG+R Sbjct: 84 KKFGGRDILILAKRRILPKPQRGSKARPQKQKRPRSRTLTAVHDAWLDELVYPAEVVGRR 143 Query: 459 IRVKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYKKLTGREVTFEFPEP 605 IRVKLDG ++ KVHLDK+ QT + HK+ F SVY+KLTG++VTFEFP+P Sbjct: 144 IRVKLDGKKVYKVHLDKSHQTNVGHKIGVFASVYRKLTGKDVTFEFPDP 192 >U70849-11|AAK29800.1| 897|Caenorhabditis elegans Hypothetical protein F29B9.2b protein. Length = 897 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +3 Query: 465 VKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYKKLTGREVTFEF 596 VK+ GS +D Q+T K+DTF+ +++ R + + F Sbjct: 379 VKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNF 422 >U70849-10|AAK29799.1| 910|Caenorhabditis elegans Hypothetical protein F29B9.2a protein. Length = 910 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +3 Query: 465 VKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYKKLTGREVTFEF 596 VK+ GS +D Q+T K+DTF+ +++ R + + F Sbjct: 392 VKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNF 435 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,572,668 Number of Sequences: 27780 Number of extensions: 264311 Number of successful extensions: 660 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -