BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_J15 (839 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) 85 9e-17 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_34777| Best HMM Match : VWA (HMM E-Value=0) 30 2.0 SB_29467| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 >SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) Length = 112 Score = 84.6 bits (200), Expect = 9e-17 Identities = 46/114 (40%), Positives = 60/114 (52%) Frame = +3 Query: 495 PFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHFNDDYFXXXXXXXXXXXXXXEGDDIF 674 PF N PLRRIPQ YVI TST I + + KLP+H F +D+F Sbjct: 2 PFKINGVPLRRIPQSYVIATSTHIDVSDVKLPEH----AFADESYFKGEPKKKKRSEDMF 57 Query: 675 ATKKEKYVPSEQRKTDQKTVDEAVIKAIGARPDKKVLRGYLKAAFGLRSXQYPH 836 E+ PSEQR DQK VD+ ++ I A P+ ++ YL + F LR Q+PH Sbjct: 58 EEAAEEKKPSEQRIADQKAVDDQILPKISAVPN---MKKYLSSLFSLRKGQFPH 108 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/77 (28%), Positives = 35/77 (45%) Frame = +1 Query: 589 QNTSMMITSRRIRSASNVQSNAKRVMTSLPQKKRNTFHLSSAKPIRRQSTRL*SKPSEPD 768 + T ++ T++ + S+ +R S R H KP R++T SKP+EPD Sbjct: 966 RQTPLVDTTKAVGPLSSTSETRRRQSDSDSVLSRRLDH---TKPPLRKTTSNDSKPTEPD 1022 Query: 769 PTRRCSADTSKRPSDSA 819 +RR S S +A Sbjct: 1023 SSRRTYRAASMDASTTA 1039 >SB_34777| Best HMM Match : VWA (HMM E-Value=0) Length = 1268 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +2 Query: 689 EIRSI*AAQNRSEDSRRGCDQSHRSPTRQEGAPRIPQSGLRTPL 820 E++ Q + + +G ++ H QEG ++PQ G +TP+ Sbjct: 657 EVQGQEQGQGQDQSHVQGQEEGHSQDQGQEGTNQVPQQGEKTPI 700 >SB_29467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +2 Query: 386 TQPEDRNCLHSPRW*TCRQEGCTCWN-SAQRSAFSYWTFCFQFVPATPYS 532 TQ R HSPR CR CT +N + S+ T C + P +S Sbjct: 84 TQEAYRKNSHSPRKRQCRNRLCTSYNWIRNKETSSFVTLCHREKPVGHFS 133 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,415,927 Number of Sequences: 59808 Number of extensions: 562016 Number of successful extensions: 2085 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1856 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2063 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -