Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P01_F_J10
         (414 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-16|CAD27767.1|  278|Anopheles gambiae hypothetical prot...    23   3.3  
AY062204-1|AAL58565.1|  150|Anopheles gambiae cytochrome P450 CY...    22   7.7  

>AJ439060-16|CAD27767.1|  278|Anopheles gambiae hypothetical protein
           protein.
          Length = 278

 Score = 23.4 bits (48), Expect = 3.3
 Identities = 11/39 (28%), Positives = 18/39 (46%)
 Frame = +3

Query: 6   KSCPVELSKXQSLKMFKAFLITMLALFACAAADPYVVPL 122
           K  P  + K   +++ K F + +L  F      PY VP+
Sbjct: 222 KPVPYTVEKPYPIEVEKPFPVEVLKKFEVPVPKPYPVPV 260


>AY062204-1|AAL58565.1|  150|Anopheles gambiae cytochrome P450
           CYP4C28 protein.
          Length = 150

 Score = 22.2 bits (45), Expect = 7.7
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +1

Query: 163 HPYQYLPSTA 192
           HPY Y+P TA
Sbjct: 133 HPYSYIPFTA 142


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 353,172
Number of Sequences: 2352
Number of extensions: 7429
Number of successful extensions: 22
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 33777477
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)