BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_J03 (562 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.1 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 3.7 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 6.4 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 8.5 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +1 Query: 154 GILPKHVPTLAVLRPGVVTILENDGKQNKIFVSSGTI 264 G+ HVP+ + RP +V DG ++ T+ Sbjct: 99 GVKMLHVPSDHIWRPDIVLYNNADGNYEVTLMTKATV 135 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +1 Query: 154 GILPKHVPTLAVLRPGVVTILENDGKQNKIFVSSGTI 264 G+ HVP+ + RP +V DG + TI Sbjct: 99 GVKMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATI 135 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 6.4 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 136 SFSGAFGILPKHVPT 180 ++SG+ LPKH+PT Sbjct: 371 TYSGSPTELPKHLPT 385 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.0 bits (42), Expect = 8.5 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = +1 Query: 154 GILPKHVPTLAVLRPGVVTILENDGKQNKIFVSSGTI 264 G+ HVP+ + RP +V DG + T+ Sbjct: 95 GVEMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATL 131 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,733 Number of Sequences: 438 Number of extensions: 1985 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -