BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_J01 (744 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ618917-1|CAF01996.1| 199|Anopheles gambiae putative odorant-b... 23 10.0 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 10.0 >AJ618917-1|CAF01996.1| 199|Anopheles gambiae putative odorant-binding protein OBPjj1 protein. Length = 199 Score = 23.0 bits (47), Expect = 10.0 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 175 DKNCGDPFKSAKPPVECNTQDSINFNTLY-LRNILPVEVLNSV 300 DK+ D ++ P EC ++ +N +Y R + + LNSV Sbjct: 59 DKDAADKGAASMPKTECMSECILNSTGIYNRRGDVDEKKLNSV 101 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 23.0 bits (47), Expect = 10.0 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -2 Query: 236 SWVLHSTGGLALLNGSPQFLSCSLLHW*HLM 144 +W L + L ++ G FL LHW M Sbjct: 792 AWSLFTLAILVMMEGLSAFLHTLRLHWVEFM 822 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 756,439 Number of Sequences: 2352 Number of extensions: 14668 Number of successful extensions: 58 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -