BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I24 (627 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 1.2 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 2.1 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 22 4.8 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 21 6.4 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 21 6.4 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 6.4 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 8.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.4 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.8 bits (49), Expect = 1.2 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 513 CRLSTHHYWCSCLWSYEG 566 C+ T HY C C + Y G Sbjct: 76 CQDHTTHYTCHCPYGYTG 93 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 2.1 Identities = 11/48 (22%), Positives = 24/48 (50%) Frame = +1 Query: 121 QVKFKXRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQV 264 + +FK + +A+K +VV+DK K + + + + + D C + Sbjct: 198 KTRFKTINNILENLWAKKLIVVKDKKKSRSDEQTIDICMRCHDQLCDM 245 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.8 bits (44), Expect = 4.8 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 275 GLKVTILCALLIHMSCHVMV*RLV*QIMLQHIQLVCY*HEDC 400 G K IL +L ++C VMV + + IQ+V Y + +C Sbjct: 182 GNKPVILTVVLPLLACGVMVVTHITMAHFKIIQVVPYCYINC 223 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 21 FCLVSVCGRHFVTYL*NLG 77 FC++ V HF+TY +LG Sbjct: 174 FCVLYVVLLHFLTYNLSLG 192 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 21 FCLVSVCGRHFVTYL*NLG 77 FC++ V HF+TY +LG Sbjct: 174 FCVLYVVLLHFLTYNLSLG 192 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 6.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -3 Query: 403 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNK 305 E + +L ++ LNM Q + SH ++ VN+ Sbjct: 301 EQMNLLHSNDLNMHQQHHQQNMSHEELSAMVNR 333 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.0 bits (42), Expect = 8.4 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -2 Query: 587 LRPPSTAPFIAPKT 546 L PP++ P ++PK+ Sbjct: 106 LTPPNSEPLVSPKS 119 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.4 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -3 Query: 403 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRT 296 +A + IAD L ML L + + H++++R+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRS 1166 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.4 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -3 Query: 403 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRT 296 +A + IAD L ML L + + H++++R+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRS 1166 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.4 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -3 Query: 403 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRT 296 +A + IAD L ML L + + H++++R+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRS 1166 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 8.4 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -3 Query: 403 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRT 296 +A + IAD L ML L + + H++++R+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRS 1166 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,270 Number of Sequences: 336 Number of extensions: 3178 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16083914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -