BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I24 (627 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1660 + 38966999-38967001,38967685-38967757,38967841-389679... 195 2e-50 01_06_1659 + 38961637-38961639,38962361-38962433,38962531-389626... 193 1e-49 08_02_1410 - 26876243-26876497,26877129-26877239,26877240-268773... 28 7.0 03_03_0279 - 16134422-16134608,16134703-16134947,16135046-161353... 27 9.2 02_04_0381 - 22497519-22497769,22498157-22498247 27 9.2 >01_06_1660 + 38966999-38967001,38967685-38967757,38967841-38967923, 38968042-38968168,38968260-38968339,38968428-38968544, 38968711-38968845,38969046-38969215,38969300-38969417 Length = 301 Score = 195 bits (476), Expect = 2e-50 Identities = 99/180 (55%), Positives = 117/180 (65%) Frame = +1 Query: 82 LKLXXTNNTSSRYQVKFKXRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQ 261 +K TN R+QVKFK RR+GKTDY AR RL QDKNKYNTPKYR + +NKD+T Q Sbjct: 5 VKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDITAQ 61 Query: 262 VAYSRIEGDHIVCAAYSHELPRYGVKVGLTNYAAAYSTGXXXXXXXXXXXXXXXXXXXXX 441 + Y+ I GD ++ AAYSHELPRYG++VGLTNYAAAY TG Sbjct: 62 IVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGNI 121 Query: 442 XXXXXEYNVEPVDNGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNVPHSIKRFPXY 621 +Y VEP D FR LDVGL RTTTG RVFGA+KGA+DGGL++PHS KRF + Sbjct: 122 EATGEDYYVEPADE-RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF 180 >01_06_1659 + 38961637-38961639,38962361-38962433,38962531-38962613, 38962732-38962858,38962950-38963029,38963112-38963228, 38963393-38963527,38963714-38963883,38963970-38964087 Length = 301 Score = 193 bits (470), Expect = 1e-49 Identities = 98/180 (54%), Positives = 117/180 (65%) Frame = +1 Query: 82 LKLXXTNNTSSRYQVKFKXRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQ 261 +K T+ R+QVKFK RR+GKTDY AR RL QDKNKYNTPKYR + +NKD+T Q Sbjct: 5 VKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDITAQ 61 Query: 262 VAYSRIEGDHIVCAAYSHELPRYGVKVGLTNYAAAYSTGXXXXXXXXXXXXXXXXXXXXX 441 + Y+ I GD ++ AAYSHELPRYG++VGLTNYAAAY TG Sbjct: 62 IVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEGNV 121 Query: 442 XXXXXEYNVEPVDNGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNVPHSIKRFPXY 621 +Y VEP D FR LDVGL RTTTG RVFGA+KGA+DGGL++PHS KRF + Sbjct: 122 EATGEDYYVEPADE-RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF 180 >08_02_1410 - 26876243-26876497,26877129-26877239,26877240-26877324, 26877620-26877672,26878318-26878440,26878514-26878597, 26878708-26878773,26879512-26879584,26879854-26879888, 26879970-26880212 Length = 375 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +1 Query: 199 KYNTPKYRLIVRLSNKDVTCQVAYSRI--EGDHIVCAAYSHEL 321 +YNT +YR + +S K V C+ + + E DH+ A S L Sbjct: 274 RYNTSRYRELPHISIKCVFCKASVEPMGEESDHVHIIALSDAL 316 >03_03_0279 - 16134422-16134608,16134703-16134947,16135046-16135364, 16135451-16135675,16135780-16135946,16136030-16136146, 16136234-16136407,16136489-16136584,16136669-16136885, 16137005-16137123,16137249-16137441,16137562-16137713, 16137809-16137938,16138667-16138776 Length = 816 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 260 WHVTSLLERRTIRRYLGVLY 201 W S LERR RRYL +LY Sbjct: 775 WKYVSNLERRETRRYLEMLY 794 >02_04_0381 - 22497519-22497769,22498157-22498247 Length = 113 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 330 WCEGWSDKLCCSIFNWSAISTKTASK 407 +C+G+ DK CC +WS K SK Sbjct: 90 YCDGYDDKSCCD--DWSGDCHKCCSK 113 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,440,771 Number of Sequences: 37544 Number of extensions: 320088 Number of successful extensions: 735 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -