BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I24 (627 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 270 2e-74 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 4.5 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 24 4.5 AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. 23 6.0 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 270 bits (663), Expect = 2e-74 Identities = 126/182 (69%), Positives = 138/182 (75%) Frame = +1 Query: 82 LKLXXTNNTSSRYQVKFKXRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQ 261 +K+ RYQV+F+ RREGKTDYYARKRL+ QDKNKYNTPK+RLIVRLSN+D+TCQ Sbjct: 4 VKVVKNKQYFKRYQVRFRRRREGKTDYYARKRLIFQDKNKYNTPKFRLIVRLSNRDITCQ 63 Query: 262 VAYSRIEGDHIVCAAYSHELPRYGVKVGLTNYAAAYSTGXXXXXXXXXXXXXXXXXXXXX 441 +AY RIEGD IVCAAYSHELPRYGVKVGLTNYAAAY TG Sbjct: 64 IAYRRIEGDRIVCAAYSHELPRYGVKVGLTNYAAAYCTGLLVARRILQKLRLDTLYAGCT 123 Query: 442 XXXXXEYNVEPVDNGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNVPHSIKRFPXY 621 EY VEPVD GP AFRCYLDVGLARTTTG+RVFGAMKGAVDGGLN+PHS+KRFP Y Sbjct: 124 DVTGEEYLVEPVDEGPAAFRCYLDVGLARTTTGSRVFGAMKGAVDGGLNIPHSVKRFPGY 183 Query: 622 DA 627 A Sbjct: 184 SA 185 Score = 27.9 bits (59), Expect = 0.28 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +3 Query: 72 LGFVKVVXHKQYFK 113 +GFVKVV +KQYFK Sbjct: 1 MGFVKVVKNKQYFK 14 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.8 bits (49), Expect = 4.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 Query: 580 HRQQHPS*LQRHEH 539 H+QQHP Q H H Sbjct: 173 HQQQHPGHSQHHHH 186 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 23.8 bits (49), Expect = 4.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 416 LTPYTLAQQMSQVMNTMLNLSTMDQEHL 499 LTP + +M Q+ TML ++T HL Sbjct: 137 LTPTFTSGRMKQMFGTMLQVATELHRHL 164 >AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. Length = 401 Score = 23.4 bits (48), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 310 NKQRTQYGHLQSESRPPGML 251 +KQ +Y H E +PPG L Sbjct: 152 SKQALKYYHYYLEGQPPGQL 171 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,654 Number of Sequences: 2352 Number of extensions: 13306 Number of successful extensions: 43 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -