BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P01_F_I23 (595 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53338-6|AAA96194.1| 147|Caenorhabditis elegans Hypothetical pr... 34 0.088 Z78064-8|CAO82042.1| 357|Caenorhabditis elegans Hypothetical pr... 28 4.4 >U53338-6|AAA96194.1| 147|Caenorhabditis elegans Hypothetical protein C05E11.2 protein. Length = 147 Score = 33.9 bits (74), Expect = 0.088 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -2 Query: 555 TLMCNXLLLSVYSCL-VFLFRNKIRFSCMKAYTKSYLII*CWPIILLGTF 409 T M L+ +YSC+ V+L N + + YT +++I CW L G + Sbjct: 75 TFMIKCFLILIYSCIIVYLSDNPANRNTVAVYTLIFVLIHCWEQFLYGFY 124 >Z78064-8|CAO82042.1| 357|Caenorhabditis elegans Hypothetical protein F57B1.9a protein. Length = 357 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 567 CEICTLMCNXLLLSVYSCLVFLFRN 493 C L CN L+++V C VF FRN Sbjct: 136 CHYTILFCN-LVIAVQRCFVFFFRN 159 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,032,452 Number of Sequences: 27780 Number of extensions: 192079 Number of successful extensions: 460 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1258229602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -